Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WK69

Protein Details
Accession A0A0B2WK69    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
75-107TSAATDKPEKRKRDRKVGKRASRRRSTLSPRELBasic
NLS Segment(s)
PositionSequence
21-29RAKLRAARG
81-99KPEKRKRDRKVGKRASRRR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, mito 6
Family & Domain DBs
Amino Acid Sequences MSNIAAKLAASEKGADAARVRAKLRAARGSARGVSRPTMPRSSPNDAAMPNTRERASPERKVAEGRDAEEQSRVTSAATDKPEKRKRDRKVGKRASRRRSTLSPRELETLISGTTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.2
5 0.24
6 0.26
7 0.27
8 0.27
9 0.31
10 0.35
11 0.4
12 0.41
13 0.39
14 0.4
15 0.43
16 0.44
17 0.43
18 0.4
19 0.37
20 0.32
21 0.3
22 0.31
23 0.33
24 0.33
25 0.34
26 0.33
27 0.37
28 0.42
29 0.47
30 0.44
31 0.41
32 0.39
33 0.34
34 0.36
35 0.33
36 0.29
37 0.24
38 0.23
39 0.21
40 0.19
41 0.23
42 0.28
43 0.3
44 0.32
45 0.36
46 0.35
47 0.36
48 0.38
49 0.34
50 0.32
51 0.27
52 0.23
53 0.24
54 0.23
55 0.23
56 0.22
57 0.22
58 0.16
59 0.15
60 0.14
61 0.08
62 0.09
63 0.1
64 0.14
65 0.18
66 0.24
67 0.29
68 0.39
69 0.47
70 0.54
71 0.63
72 0.68
73 0.72
74 0.77
75 0.83
76 0.83
77 0.87
78 0.9
79 0.9
80 0.92
81 0.93
82 0.92
83 0.91
84 0.86
85 0.83
86 0.82
87 0.81
88 0.8
89 0.79
90 0.73
91 0.66
92 0.65
93 0.57
94 0.48
95 0.4
96 0.32