Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B2X1L5

Protein Details
Accession A0A0B2X1L5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80MIRSNRKKAAKAKAAAKKKNHydrophilic
NLS Segment(s)
PositionSequence
65-80NRKKAAKAKAAAKKKN
Subcellular Location(s) plas 21, E.R. 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0016757  F:glycosyltransferase activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLVASSVIFLYYTIWTLVMPFVDKDHPLQDFFLHRKWAIRIPVILILLGSAVVGSFLGLVMIRSNRKKAAKAKAAAKKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.08
6 0.08
7 0.08
8 0.09
9 0.11
10 0.12
11 0.13
12 0.15
13 0.16
14 0.16
15 0.16
16 0.16
17 0.19
18 0.21
19 0.23
20 0.22
21 0.21
22 0.23
23 0.24
24 0.27
25 0.24
26 0.23
27 0.21
28 0.2
29 0.22
30 0.19
31 0.17
32 0.12
33 0.09
34 0.07
35 0.07
36 0.05
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.05
48 0.09
49 0.16
50 0.19
51 0.23
52 0.3
53 0.35
54 0.43
55 0.49
56 0.57
57 0.6
58 0.65
59 0.72
60 0.75