Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B2WUC2

Protein Details
Accession A0A0B2WUC2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-38VSNGKATKRRNGKAAKLRNGNASHydrophilic
NLS Segment(s)
PositionSequence
23-30KRRNGKAA
144-151HARRPRKR
Subcellular Location(s) plas 21, mito 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004299  MBOAT_fam  
IPR014371  Oat_ACAT_DAG_ARE  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0004144  F:diacylglycerol O-acyltransferase activity  
Pfam View protein in Pfam  
PF03062  MBOAT  
Amino Acid Sequences MTTATTTSVSPANGIVSNGKATKRRNGKAAKLRNGNASPDLAEEECDDASTVDKTPAALVQKYRHVAAVHSKSRPSCLSHDSDAAPSFIGFRNLMVIVLGMPHRTRAVFYVLIIPDRSLSGLLYFLIPCHLLVAYLIELAAARHARRPRKRLEPASPGPSEQDKIKFHSTWVLAAWAHGINMTLAFALTTFVVYYYIHHPLVGTLTEMHAVIVSLKTASYAFTNRDLRHAYMHPVRGELIPELYSKCPYPNNITFGNLVYFWWAPTLVYQPVYPRTDKIRWVFVFKRLGEVCCLSAFIWFASFQYAAPVLQNSLDKIASLDLLMILERLLKLSTISLVIWLAGFFALFQSFLNALAEVLRFADRSFYDDWWNSESLGAYWRTWNKPVYTYFKRHVYVPMIGRGWSPWTASCTVFFVSAVLHEVLVGVPTHNIIGVAFLGMFLQLPLIAITAPLEKMKWGHTGRVMGNVIFWVSFTIFGQPFAALMYFYAWQAKYGSVSKQPILTLQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.2
5 0.23
6 0.27
7 0.32
8 0.35
9 0.44
10 0.52
11 0.56
12 0.61
13 0.67
14 0.73
15 0.77
16 0.83
17 0.83
18 0.82
19 0.8
20 0.8
21 0.74
22 0.67
23 0.59
24 0.5
25 0.41
26 0.33
27 0.32
28 0.23
29 0.2
30 0.17
31 0.16
32 0.14
33 0.14
34 0.12
35 0.09
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.11
42 0.12
43 0.16
44 0.19
45 0.21
46 0.26
47 0.29
48 0.37
49 0.39
50 0.38
51 0.38
52 0.34
53 0.34
54 0.39
55 0.44
56 0.43
57 0.45
58 0.49
59 0.46
60 0.51
61 0.5
62 0.44
63 0.4
64 0.39
65 0.41
66 0.4
67 0.43
68 0.39
69 0.39
70 0.36
71 0.3
72 0.24
73 0.18
74 0.17
75 0.15
76 0.16
77 0.13
78 0.12
79 0.14
80 0.14
81 0.13
82 0.11
83 0.1
84 0.07
85 0.09
86 0.09
87 0.09
88 0.09
89 0.1
90 0.11
91 0.12
92 0.13
93 0.13
94 0.17
95 0.16
96 0.17
97 0.23
98 0.23
99 0.24
100 0.24
101 0.22
102 0.17
103 0.17
104 0.16
105 0.09
106 0.08
107 0.07
108 0.07
109 0.07
110 0.08
111 0.08
112 0.07
113 0.08
114 0.08
115 0.07
116 0.08
117 0.07
118 0.06
119 0.06
120 0.08
121 0.07
122 0.06
123 0.06
124 0.05
125 0.05
126 0.05
127 0.08
128 0.09
129 0.09
130 0.15
131 0.22
132 0.33
133 0.42
134 0.49
135 0.54
136 0.63
137 0.73
138 0.76
139 0.78
140 0.78
141 0.76
142 0.76
143 0.69
144 0.58
145 0.51
146 0.44
147 0.37
148 0.3
149 0.3
150 0.26
151 0.29
152 0.34
153 0.31
154 0.29
155 0.34
156 0.31
157 0.26
158 0.24
159 0.22
160 0.17
161 0.16
162 0.17
163 0.11
164 0.1
165 0.09
166 0.08
167 0.06
168 0.06
169 0.06
170 0.04
171 0.04
172 0.03
173 0.03
174 0.04
175 0.04
176 0.04
177 0.03
178 0.04
179 0.05
180 0.05
181 0.07
182 0.09
183 0.13
184 0.13
185 0.13
186 0.13
187 0.12
188 0.14
189 0.12
190 0.09
191 0.06
192 0.07
193 0.07
194 0.07
195 0.07
196 0.05
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.06
207 0.08
208 0.1
209 0.16
210 0.22
211 0.22
212 0.26
213 0.27
214 0.26
215 0.28
216 0.28
217 0.27
218 0.27
219 0.3
220 0.27
221 0.25
222 0.25
223 0.22
224 0.21
225 0.16
226 0.12
227 0.09
228 0.1
229 0.11
230 0.1
231 0.11
232 0.1
233 0.12
234 0.13
235 0.14
236 0.21
237 0.23
238 0.25
239 0.25
240 0.26
241 0.25
242 0.24
243 0.22
244 0.15
245 0.11
246 0.1
247 0.09
248 0.07
249 0.07
250 0.06
251 0.06
252 0.06
253 0.09
254 0.08
255 0.09
256 0.1
257 0.11
258 0.17
259 0.19
260 0.19
261 0.18
262 0.24
263 0.26
264 0.31
265 0.32
266 0.35
267 0.34
268 0.41
269 0.41
270 0.41
271 0.45
272 0.39
273 0.43
274 0.35
275 0.35
276 0.3
277 0.29
278 0.23
279 0.16
280 0.17
281 0.1
282 0.1
283 0.1
284 0.07
285 0.07
286 0.06
287 0.06
288 0.07
289 0.07
290 0.07
291 0.08
292 0.08
293 0.07
294 0.08
295 0.08
296 0.07
297 0.08
298 0.09
299 0.08
300 0.09
301 0.09
302 0.08
303 0.09
304 0.09
305 0.07
306 0.06
307 0.06
308 0.04
309 0.05
310 0.05
311 0.04
312 0.04
313 0.04
314 0.04
315 0.05
316 0.05
317 0.05
318 0.05
319 0.06
320 0.06
321 0.07
322 0.07
323 0.07
324 0.07
325 0.07
326 0.06
327 0.06
328 0.05
329 0.04
330 0.04
331 0.03
332 0.04
333 0.04
334 0.04
335 0.04
336 0.06
337 0.06
338 0.07
339 0.07
340 0.07
341 0.07
342 0.08
343 0.08
344 0.06
345 0.07
346 0.07
347 0.07
348 0.07
349 0.11
350 0.1
351 0.13
352 0.15
353 0.16
354 0.21
355 0.22
356 0.25
357 0.24
358 0.24
359 0.21
360 0.2
361 0.19
362 0.14
363 0.16
364 0.15
365 0.13
366 0.18
367 0.24
368 0.26
369 0.3
370 0.33
371 0.31
372 0.35
373 0.41
374 0.45
375 0.47
376 0.5
377 0.52
378 0.56
379 0.55
380 0.51
381 0.51
382 0.46
383 0.45
384 0.42
385 0.43
386 0.36
387 0.35
388 0.34
389 0.29
390 0.27
391 0.22
392 0.2
393 0.15
394 0.18
395 0.2
396 0.2
397 0.21
398 0.2
399 0.19
400 0.18
401 0.16
402 0.12
403 0.1
404 0.1
405 0.12
406 0.09
407 0.08
408 0.08
409 0.08
410 0.08
411 0.08
412 0.08
413 0.06
414 0.06
415 0.06
416 0.06
417 0.06
418 0.06
419 0.05
420 0.06
421 0.06
422 0.06
423 0.05
424 0.05
425 0.05
426 0.05
427 0.05
428 0.04
429 0.04
430 0.04
431 0.04
432 0.04
433 0.05
434 0.05
435 0.05
436 0.06
437 0.08
438 0.09
439 0.1
440 0.1
441 0.11
442 0.13
443 0.16
444 0.24
445 0.24
446 0.29
447 0.33
448 0.4
449 0.39
450 0.46
451 0.44
452 0.35
453 0.34
454 0.29
455 0.24
456 0.17
457 0.16
458 0.1
459 0.09
460 0.1
461 0.1
462 0.16
463 0.15
464 0.16
465 0.17
466 0.15
467 0.15
468 0.15
469 0.14
470 0.08
471 0.08
472 0.09
473 0.09
474 0.1
475 0.15
476 0.14
477 0.15
478 0.17
479 0.18
480 0.2
481 0.23
482 0.28
483 0.31
484 0.36
485 0.37
486 0.39
487 0.39