Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KEU0

Protein Details
Accession Q5KEU0   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
186-208REDYPSYKKKVKRLARRSAEEAYHydrophilic
NLS Segment(s)
PositionSequence
195-198KVKR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000608  UBQ-conjugat_E2  
IPR016135  UBQ-conjugating_enzyme/RWD  
Gene Ontology GO:0061631  F:ubiquitin conjugating enzyme activity  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
GO:0000209  P:protein polyubiquitination  
KEGG cne:CNF04270  -  
Pfam View protein in Pfam  
PF00179  UQ_con  
PROSITE View protein in PROSITE  
PS50127  UBC_2  
CDD cd00195  UBCc  
Amino Acid Sequences MMPPTPRTNASSSSSPYPPSRPNSAKPAISSNGNSSTANSSLILRKQLMELQKHPVDGFSAGLVDDDNMLEWDIVIMGPVDTLWEGAILKARLIFPPEYPLLPPKMIFDSEMWHPNIYNKGDKKGEVCVSILHQPGEDEWGFEDAGERWLPVHTVESVLISVISLLSQDVPDLSSPANVDAAKEVREDYPSYKKKVKRLARRSAEEAYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.41
4 0.42
5 0.44
6 0.44
7 0.5
8 0.51
9 0.54
10 0.59
11 0.62
12 0.59
13 0.54
14 0.55
15 0.48
16 0.46
17 0.42
18 0.38
19 0.36
20 0.35
21 0.33
22 0.28
23 0.28
24 0.25
25 0.23
26 0.19
27 0.17
28 0.19
29 0.22
30 0.23
31 0.2
32 0.2
33 0.21
34 0.25
35 0.29
36 0.3
37 0.3
38 0.35
39 0.36
40 0.36
41 0.34
42 0.3
43 0.25
44 0.2
45 0.18
46 0.1
47 0.08
48 0.07
49 0.07
50 0.07
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.07
75 0.07
76 0.07
77 0.09
78 0.09
79 0.1
80 0.12
81 0.13
82 0.1
83 0.14
84 0.15
85 0.14
86 0.14
87 0.15
88 0.15
89 0.15
90 0.14
91 0.12
92 0.13
93 0.12
94 0.13
95 0.11
96 0.12
97 0.13
98 0.17
99 0.17
100 0.15
101 0.15
102 0.16
103 0.21
104 0.2
105 0.25
106 0.23
107 0.27
108 0.29
109 0.29
110 0.29
111 0.29
112 0.29
113 0.23
114 0.22
115 0.18
116 0.18
117 0.22
118 0.22
119 0.16
120 0.14
121 0.13
122 0.13
123 0.16
124 0.14
125 0.1
126 0.09
127 0.1
128 0.1
129 0.1
130 0.11
131 0.07
132 0.1
133 0.09
134 0.09
135 0.08
136 0.08
137 0.09
138 0.08
139 0.1
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.08
147 0.06
148 0.06
149 0.04
150 0.04
151 0.03
152 0.03
153 0.04
154 0.04
155 0.04
156 0.05
157 0.06
158 0.06
159 0.07
160 0.07
161 0.08
162 0.09
163 0.1
164 0.13
165 0.12
166 0.12
167 0.15
168 0.16
169 0.16
170 0.16
171 0.17
172 0.15
173 0.18
174 0.2
175 0.22
176 0.31
177 0.37
178 0.43
179 0.5
180 0.55
181 0.61
182 0.69
183 0.74
184 0.75
185 0.79
186 0.83
187 0.85
188 0.87
189 0.84