Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WU15

Protein Details
Accession A0A0B2WU15   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-41GLFSRRPRQVHHQKRKPTVRDKVSBasic
NLS Segment(s)
PositionSequence
22-76RRPRQVHHQKRKPTVRDKVSGALMKLRASLTRRPGLKAAGTRRMRGTDGRGGHKH
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPFGHRAHHQTTTTTRPGLFSRRPRQVHHQKRKPTVRDKVSGALMKLRASLTRRPGLKAAGTRRMRGTDGRGGHKHGHAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.33
4 0.35
5 0.38
6 0.41
7 0.44
8 0.49
9 0.57
10 0.61
11 0.63
12 0.7
13 0.74
14 0.76
15 0.77
16 0.78
17 0.77
18 0.83
19 0.88
20 0.86
21 0.84
22 0.82
23 0.76
24 0.72
25 0.65
26 0.58
27 0.52
28 0.45
29 0.36
30 0.3
31 0.25
32 0.2
33 0.19
34 0.16
35 0.16
36 0.18
37 0.23
38 0.26
39 0.31
40 0.32
41 0.33
42 0.35
43 0.35
44 0.36
45 0.39
46 0.4
47 0.44
48 0.45
49 0.46
50 0.47
51 0.47
52 0.45
53 0.41
54 0.4
55 0.38
56 0.41
57 0.47
58 0.47
59 0.49
60 0.51