Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B2WP72

Protein Details
Accession A0A0B2WP72    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-109SKKFSGKPAKVSKPNHVRNRAHydrophilic
NLS Segment(s)
PositionSequence
87-108ASSKKFSGKPAKVSKPNHVRNR
Subcellular Location(s) extr 22, mito 4
Family & Domain DBs
Amino Acid Sequences MRAALITTLVSLAGIAFAAPPGSRGGLETRGGSRGICVPKAKRELENCLDRGETGLPCLEAYANTYAECRGFPQRFGKQSGSASKAASSKKFSGKPAKVSKPNHVRNRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.07
11 0.09
12 0.12
13 0.14
14 0.16
15 0.17
16 0.17
17 0.18
18 0.18
19 0.17
20 0.15
21 0.18
22 0.19
23 0.21
24 0.24
25 0.26
26 0.32
27 0.39
28 0.4
29 0.39
30 0.4
31 0.44
32 0.46
33 0.48
34 0.42
35 0.37
36 0.35
37 0.29
38 0.27
39 0.21
40 0.14
41 0.09
42 0.08
43 0.07
44 0.07
45 0.07
46 0.06
47 0.04
48 0.07
49 0.08
50 0.08
51 0.08
52 0.09
53 0.09
54 0.09
55 0.09
56 0.1
57 0.17
58 0.17
59 0.2
60 0.28
61 0.35
62 0.39
63 0.44
64 0.44
65 0.4
66 0.45
67 0.48
68 0.44
69 0.39
70 0.35
71 0.33
72 0.35
73 0.35
74 0.34
75 0.34
76 0.35
77 0.42
78 0.46
79 0.5
80 0.56
81 0.59
82 0.64
83 0.69
84 0.74
85 0.75
86 0.76
87 0.79
88 0.79
89 0.83