Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B2X7E3

Protein Details
Accession A0A0B2X7E3    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-40GGALKLKGAKVQKKKKRRDKSGLERTLSAHydrophilic
NLS Segment(s)
PositionSequence
16-32KLKGAKVQKKKKRRDKS
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSGDYAAVGGGGALKLKGAKVQKKKKRRDKSGLERTLSAGEGASAKGDGTSANERQPDEHGQDRHSDDDAAVARKTESERKYDEVRKKRLQKMAESSSSRPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.07
5 0.13
6 0.21
7 0.3
8 0.41
9 0.52
10 0.62
11 0.72
12 0.83
13 0.88
14 0.91
15 0.92
16 0.92
17 0.92
18 0.93
19 0.94
20 0.91
21 0.83
22 0.72
23 0.63
24 0.54
25 0.43
26 0.31
27 0.2
28 0.12
29 0.1
30 0.09
31 0.07
32 0.05
33 0.05
34 0.05
35 0.05
36 0.04
37 0.07
38 0.12
39 0.13
40 0.16
41 0.18
42 0.18
43 0.19
44 0.22
45 0.21
46 0.21
47 0.25
48 0.24
49 0.23
50 0.27
51 0.27
52 0.25
53 0.23
54 0.19
55 0.13
56 0.15
57 0.15
58 0.13
59 0.12
60 0.11
61 0.1
62 0.11
63 0.14
64 0.18
65 0.18
66 0.21
67 0.24
68 0.28
69 0.35
70 0.43
71 0.5
72 0.52
73 0.6
74 0.65
75 0.72
76 0.76
77 0.75
78 0.71
79 0.7
80 0.69
81 0.67
82 0.66
83 0.61
84 0.55
85 0.54
86 0.51
87 0.43
88 0.35
89 0.29
90 0.28
91 0.31
92 0.4
93 0.4
94 0.47
95 0.5
96 0.52
97 0.53
98 0.54
99 0.54
100 0.46
101 0.42
102 0.41
103 0.38
104 0.37
105 0.35
106 0.28
107 0.21
108 0.19
109 0.2
110 0.19
111 0.21
112 0.27
113 0.33
114 0.34