Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WWT7

Protein Details
Accession A0A0B2WWT7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSRFQKRRHRLRLRAVDGVHydrophilic
77-103KYTMFDRKAKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
83-97RKAKRYRKGIHKLPK
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLSGGLLWKIPWRLSRFQKRRHRLRLRAVDGVVATLHSALANKGQTLEALERWKTEMPTEAEMLPRDKYTMFDRKAKRYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.26
8 0.29
9 0.36
10 0.45
11 0.56
12 0.61
13 0.7
14 0.78
15 0.82
16 0.87
17 0.9
18 0.9
19 0.88
20 0.9
21 0.9
22 0.84
23 0.79
24 0.68
25 0.59
26 0.48
27 0.39
28 0.28
29 0.17
30 0.11
31 0.06
32 0.06
33 0.04
34 0.04
35 0.04
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.09
43 0.1
44 0.09
45 0.12
46 0.12
47 0.12
48 0.14
49 0.15
50 0.14
51 0.14
52 0.17
53 0.17
54 0.19
55 0.2
56 0.18
57 0.19
58 0.2
59 0.21
60 0.17
61 0.14
62 0.13
63 0.12
64 0.14
65 0.19
66 0.27
67 0.29
68 0.37
69 0.43
70 0.53
71 0.62
72 0.69
73 0.71
74 0.71
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79