Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5K9F0

Protein Details
Accession Q5K9F0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
346-366EEEEKEQKEEERRRKRARFDTAcidic
NLS Segment(s)
PositionSequence
357-361RRRKR
Subcellular Location(s) nucl 15.5, mito_nucl 11.5, mito 6.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR019956  Ubiquitin_dom  
Gene Ontology GO:0031386  F:protein tag  
GO:0031625  F:ubiquitin protein ligase binding  
GO:0019941  P:modification-dependent protein catabolic process  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MPLYACTTIGTMRISIVLLGGSQTELSVHPWNSVRDVKAKYELQAEIQGKHSLQPDFQRMFYQGRQLEDPWLLSECNIQHGSTLHVCPELHRELHFKVELRLGEKLADSTVNVIACFDERTFKAVRPRMNRETDPNKSCSFTNIVKRKGIDMPWEQEFGHQPTTIPSRLIVPVPASASSSQSSAAARLPRAPSPPDILAPRVSRNKPIAPSRSVHAVATASRPRQSNRKQPTDKEKSALVVAKSTTITLRVQNLQHQTSYYDVMADDPVEHLRAKITWKEGVPLEGLQLCYGRNLLNDGRLLKDYKLRKNSIVRMNREVGEPGLRRTRGLVINVSDGHDDDEEEEEEEEKEQKEEERRRKRARFDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.08
5 0.07
6 0.07
7 0.07
8 0.06
9 0.06
10 0.06
11 0.07
12 0.07
13 0.11
14 0.17
15 0.17
16 0.21
17 0.25
18 0.26
19 0.31
20 0.36
21 0.35
22 0.37
23 0.4
24 0.4
25 0.44
26 0.45
27 0.42
28 0.42
29 0.4
30 0.35
31 0.4
32 0.38
33 0.32
34 0.33
35 0.33
36 0.28
37 0.31
38 0.32
39 0.25
40 0.27
41 0.32
42 0.37
43 0.37
44 0.38
45 0.36
46 0.35
47 0.38
48 0.37
49 0.39
50 0.33
51 0.34
52 0.36
53 0.34
54 0.35
55 0.31
56 0.3
57 0.22
58 0.21
59 0.18
60 0.15
61 0.18
62 0.15
63 0.19
64 0.19
65 0.17
66 0.17
67 0.18
68 0.22
69 0.21
70 0.21
71 0.17
72 0.18
73 0.18
74 0.18
75 0.24
76 0.23
77 0.21
78 0.22
79 0.26
80 0.24
81 0.3
82 0.31
83 0.26
84 0.25
85 0.28
86 0.28
87 0.26
88 0.27
89 0.22
90 0.2
91 0.2
92 0.18
93 0.14
94 0.12
95 0.09
96 0.1
97 0.11
98 0.1
99 0.1
100 0.09
101 0.09
102 0.09
103 0.1
104 0.09
105 0.1
106 0.1
107 0.14
108 0.15
109 0.18
110 0.27
111 0.3
112 0.38
113 0.43
114 0.51
115 0.56
116 0.61
117 0.6
118 0.6
119 0.63
120 0.64
121 0.6
122 0.55
123 0.49
124 0.44
125 0.41
126 0.35
127 0.32
128 0.29
129 0.35
130 0.39
131 0.41
132 0.42
133 0.42
134 0.43
135 0.41
136 0.37
137 0.34
138 0.3
139 0.3
140 0.29
141 0.3
142 0.27
143 0.25
144 0.26
145 0.22
146 0.2
147 0.16
148 0.15
149 0.16
150 0.2
151 0.19
152 0.16
153 0.14
154 0.14
155 0.15
156 0.15
157 0.13
158 0.1
159 0.11
160 0.11
161 0.11
162 0.1
163 0.1
164 0.11
165 0.11
166 0.1
167 0.09
168 0.09
169 0.09
170 0.09
171 0.11
172 0.11
173 0.11
174 0.15
175 0.16
176 0.18
177 0.2
178 0.21
179 0.2
180 0.22
181 0.22
182 0.21
183 0.2
184 0.2
185 0.21
186 0.21
187 0.25
188 0.29
189 0.29
190 0.32
191 0.34
192 0.37
193 0.38
194 0.44
195 0.44
196 0.39
197 0.39
198 0.36
199 0.38
200 0.35
201 0.29
202 0.23
203 0.19
204 0.17
205 0.21
206 0.24
207 0.2
208 0.22
209 0.24
210 0.25
211 0.35
212 0.42
213 0.47
214 0.51
215 0.61
216 0.64
217 0.7
218 0.78
219 0.78
220 0.73
221 0.65
222 0.57
223 0.47
224 0.45
225 0.41
226 0.3
227 0.22
228 0.2
229 0.19
230 0.18
231 0.17
232 0.14
233 0.12
234 0.13
235 0.14
236 0.17
237 0.2
238 0.21
239 0.27
240 0.32
241 0.31
242 0.3
243 0.28
244 0.26
245 0.23
246 0.24
247 0.17
248 0.12
249 0.11
250 0.11
251 0.11
252 0.1
253 0.08
254 0.07
255 0.08
256 0.09
257 0.09
258 0.08
259 0.09
260 0.11
261 0.14
262 0.17
263 0.2
264 0.23
265 0.24
266 0.28
267 0.27
268 0.27
269 0.25
270 0.21
271 0.2
272 0.18
273 0.17
274 0.14
275 0.14
276 0.12
277 0.11
278 0.12
279 0.11
280 0.09
281 0.13
282 0.14
283 0.17
284 0.2
285 0.21
286 0.23
287 0.24
288 0.26
289 0.24
290 0.3
291 0.35
292 0.41
293 0.49
294 0.5
295 0.56
296 0.63
297 0.7
298 0.72
299 0.73
300 0.7
301 0.68
302 0.68
303 0.62
304 0.54
305 0.47
306 0.39
307 0.38
308 0.33
309 0.32
310 0.36
311 0.35
312 0.34
313 0.35
314 0.4
315 0.36
316 0.38
317 0.38
318 0.32
319 0.37
320 0.38
321 0.37
322 0.31
323 0.26
324 0.25
325 0.19
326 0.17
327 0.13
328 0.15
329 0.14
330 0.14
331 0.14
332 0.13
333 0.13
334 0.14
335 0.16
336 0.14
337 0.14
338 0.14
339 0.2
340 0.29
341 0.4
342 0.49
343 0.57
344 0.67
345 0.77
346 0.85