Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WUW6

Protein Details
Accession A0A0B2WUW6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
108-128DEFSKSKKQRKLATKRQKALEHydrophilic
168-195ADKREELRKAMRKERKAKIKETNYLKSMHydrophilic
NLS Segment(s)
PositionSequence
114-123KKQRKLATKR
172-187EELRKAMRKERKAKIK
Subcellular Location(s) mito 23.5, cyto_mito 13.833, mito_nucl 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLCTRCIRTAIAGQRLPLLRQFSASAQFLSAEPKLSTPTTDGGSPVPSKESSTPRSICPEGTVLTGLNYNKAGQDPVAKKDEEYPEWLWSCLDVMRKGADAADDNAGDEFSKSKKQRKLATKRQKALEAKLLAEGNLAALAPKVPIQHQSINLPGEVGGSVADNIAAADKREELRKAMRKERKAKIKETNYLKSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.42
4 0.39
5 0.35
6 0.26
7 0.27
8 0.28
9 0.25
10 0.28
11 0.28
12 0.24
13 0.19
14 0.2
15 0.18
16 0.2
17 0.18
18 0.15
19 0.14
20 0.15
21 0.17
22 0.17
23 0.18
24 0.16
25 0.17
26 0.16
27 0.17
28 0.17
29 0.15
30 0.18
31 0.18
32 0.16
33 0.16
34 0.15
35 0.17
36 0.22
37 0.28
38 0.28
39 0.35
40 0.36
41 0.36
42 0.42
43 0.4
44 0.35
45 0.3
46 0.28
47 0.22
48 0.21
49 0.19
50 0.12
51 0.12
52 0.15
53 0.13
54 0.12
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.08
61 0.16
62 0.18
63 0.21
64 0.24
65 0.23
66 0.23
67 0.29
68 0.32
69 0.25
70 0.28
71 0.25
72 0.26
73 0.27
74 0.26
75 0.2
76 0.16
77 0.15
78 0.12
79 0.13
80 0.1
81 0.1
82 0.1
83 0.11
84 0.11
85 0.1
86 0.09
87 0.07
88 0.08
89 0.09
90 0.08
91 0.08
92 0.08
93 0.08
94 0.07
95 0.06
96 0.06
97 0.06
98 0.14
99 0.18
100 0.27
101 0.33
102 0.4
103 0.49
104 0.59
105 0.68
106 0.72
107 0.79
108 0.81
109 0.82
110 0.79
111 0.79
112 0.71
113 0.65
114 0.62
115 0.52
116 0.43
117 0.39
118 0.35
119 0.26
120 0.23
121 0.18
122 0.1
123 0.08
124 0.07
125 0.04
126 0.04
127 0.04
128 0.04
129 0.06
130 0.07
131 0.08
132 0.12
133 0.17
134 0.21
135 0.24
136 0.26
137 0.29
138 0.29
139 0.28
140 0.24
141 0.19
142 0.16
143 0.13
144 0.1
145 0.06
146 0.05
147 0.05
148 0.05
149 0.05
150 0.04
151 0.04
152 0.06
153 0.07
154 0.07
155 0.08
156 0.11
157 0.14
158 0.19
159 0.21
160 0.23
161 0.33
162 0.41
163 0.49
164 0.57
165 0.65
166 0.7
167 0.79
168 0.85
169 0.85
170 0.84
171 0.85
172 0.85
173 0.84
174 0.84
175 0.83