Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WR42

Protein Details
Accession A0A0B2WR42    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MARRRAKKRTHVGANNPETGSHydrophilic
362-394EVGELEKRWDKRRREKEARRREQKANVERKRAEBasic
NLS Segment(s)
PositionSequence
368-404KRWDKRRREKEARRREQKANVERKRAEKEARRKGGPG
Subcellular Location(s) mito 14, cyto 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR045112  PPAN-like  
Gene Ontology GO:0019843  F:rRNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MARRRAKKRTHVGANNPETGSAGHATARDPKSMVIRIGAGEVGSSISQLAADVRKVMEPGTASRLRERRGNKLKDYVVMCGPLGVTHLMLFSRSETGNTNLRLALAPRGPTMHFRVDKYSLCRDVQRVQKHPRGGGKEFLAPPLLVMNNFATPGADSKSKVPRHLESLATTVFQSLFPPINPQQTPLKAIRRVLLLDRERSEEDDGTFVVNFRHYAITTKSTTVSRPLRRIKAAEELMATKSSRQGRVPNLGKLQDIANYMMGGEAGDGYMTDATSGSEVETDAEIEVVDNAPRRVVSTKARLAAAEHGGPEAEDEVDNVERRAVKLVELGPRMRLRLTKVEEGLCAGKVMWHEYVHKSREEVGELEKRWDKRRREKEARRREQKANVERKRAEKEARRKGGPGEGGGGGEEDDEDENYSDVDFDDLDSEGLAGDAEFKANEQMEEDVEWEGEREEIGRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.82
3 0.71
4 0.6
5 0.5
6 0.41
7 0.33
8 0.24
9 0.18
10 0.14
11 0.14
12 0.16
13 0.25
14 0.27
15 0.26
16 0.25
17 0.27
18 0.32
19 0.35
20 0.35
21 0.28
22 0.27
23 0.26
24 0.26
25 0.23
26 0.16
27 0.12
28 0.11
29 0.09
30 0.08
31 0.07
32 0.06
33 0.05
34 0.05
35 0.06
36 0.09
37 0.1
38 0.1
39 0.12
40 0.13
41 0.14
42 0.15
43 0.15
44 0.14
45 0.14
46 0.17
47 0.23
48 0.26
49 0.27
50 0.35
51 0.41
52 0.41
53 0.47
54 0.49
55 0.52
56 0.58
57 0.65
58 0.63
59 0.66
60 0.65
61 0.64
62 0.62
63 0.54
64 0.46
65 0.39
66 0.33
67 0.25
68 0.22
69 0.15
70 0.14
71 0.11
72 0.09
73 0.07
74 0.08
75 0.07
76 0.08
77 0.09
78 0.08
79 0.11
80 0.11
81 0.12
82 0.14
83 0.18
84 0.24
85 0.25
86 0.25
87 0.22
88 0.23
89 0.22
90 0.21
91 0.23
92 0.19
93 0.19
94 0.19
95 0.21
96 0.21
97 0.24
98 0.28
99 0.31
100 0.31
101 0.32
102 0.36
103 0.39
104 0.42
105 0.44
106 0.46
107 0.42
108 0.4
109 0.42
110 0.4
111 0.43
112 0.48
113 0.51
114 0.53
115 0.57
116 0.62
117 0.62
118 0.64
119 0.64
120 0.62
121 0.56
122 0.52
123 0.46
124 0.46
125 0.43
126 0.38
127 0.33
128 0.25
129 0.22
130 0.2
131 0.18
132 0.11
133 0.11
134 0.11
135 0.1
136 0.11
137 0.1
138 0.08
139 0.08
140 0.09
141 0.1
142 0.11
143 0.11
144 0.17
145 0.26
146 0.29
147 0.33
148 0.36
149 0.36
150 0.4
151 0.43
152 0.39
153 0.32
154 0.32
155 0.28
156 0.24
157 0.21
158 0.16
159 0.13
160 0.11
161 0.1
162 0.09
163 0.09
164 0.09
165 0.14
166 0.16
167 0.22
168 0.22
169 0.25
170 0.28
171 0.29
172 0.33
173 0.33
174 0.37
175 0.34
176 0.35
177 0.35
178 0.31
179 0.31
180 0.29
181 0.33
182 0.29
183 0.3
184 0.3
185 0.31
186 0.29
187 0.3
188 0.29
189 0.21
190 0.18
191 0.15
192 0.13
193 0.11
194 0.1
195 0.09
196 0.07
197 0.07
198 0.06
199 0.07
200 0.08
201 0.07
202 0.1
203 0.12
204 0.15
205 0.16
206 0.17
207 0.18
208 0.18
209 0.18
210 0.23
211 0.3
212 0.3
213 0.38
214 0.44
215 0.46
216 0.48
217 0.48
218 0.43
219 0.43
220 0.39
221 0.32
222 0.26
223 0.23
224 0.22
225 0.22
226 0.19
227 0.11
228 0.16
229 0.18
230 0.19
231 0.2
232 0.24
233 0.27
234 0.37
235 0.4
236 0.39
237 0.4
238 0.38
239 0.36
240 0.32
241 0.28
242 0.21
243 0.19
244 0.15
245 0.11
246 0.1
247 0.1
248 0.09
249 0.08
250 0.05
251 0.04
252 0.03
253 0.02
254 0.02
255 0.02
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.03
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.04
273 0.04
274 0.05
275 0.04
276 0.05
277 0.07
278 0.07
279 0.07
280 0.07
281 0.09
282 0.1
283 0.14
284 0.2
285 0.26
286 0.31
287 0.33
288 0.34
289 0.32
290 0.32
291 0.32
292 0.28
293 0.21
294 0.17
295 0.14
296 0.14
297 0.13
298 0.12
299 0.08
300 0.06
301 0.05
302 0.05
303 0.07
304 0.09
305 0.09
306 0.09
307 0.11
308 0.11
309 0.12
310 0.15
311 0.14
312 0.13
313 0.17
314 0.21
315 0.26
316 0.28
317 0.28
318 0.3
319 0.31
320 0.32
321 0.29
322 0.28
323 0.26
324 0.32
325 0.36
326 0.37
327 0.38
328 0.39
329 0.37
330 0.37
331 0.34
332 0.25
333 0.19
334 0.13
335 0.12
336 0.12
337 0.14
338 0.14
339 0.14
340 0.18
341 0.24
342 0.32
343 0.33
344 0.33
345 0.32
346 0.34
347 0.35
348 0.34
349 0.29
350 0.28
351 0.33
352 0.32
353 0.37
354 0.38
355 0.4
356 0.47
357 0.54
358 0.58
359 0.61
360 0.71
361 0.76
362 0.82
363 0.89
364 0.91
365 0.94
366 0.95
367 0.94
368 0.91
369 0.88
370 0.86
371 0.86
372 0.85
373 0.85
374 0.82
375 0.82
376 0.8
377 0.79
378 0.77
379 0.74
380 0.73
381 0.72
382 0.74
383 0.75
384 0.79
385 0.74
386 0.69
387 0.65
388 0.64
389 0.57
390 0.48
391 0.4
392 0.32
393 0.29
394 0.27
395 0.23
396 0.15
397 0.11
398 0.09
399 0.07
400 0.07
401 0.07
402 0.08
403 0.08
404 0.09
405 0.09
406 0.09
407 0.08
408 0.07
409 0.07
410 0.06
411 0.06
412 0.07
413 0.08
414 0.08
415 0.07
416 0.07
417 0.06
418 0.06
419 0.05
420 0.04
421 0.06
422 0.06
423 0.07
424 0.07
425 0.08
426 0.12
427 0.13
428 0.13
429 0.13
430 0.14
431 0.15
432 0.15
433 0.16
434 0.13
435 0.12
436 0.12
437 0.11
438 0.1
439 0.09
440 0.08