Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WNJ2

Protein Details
Accession A0A0B2WNJ2   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-111AERRRPSATMTRRLPRRRPLBasic
NLS Segment(s)
PositionSequence
102-110TRRLPRRRP
Subcellular Location(s) mito 11, nucl 9, cyto_nucl 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR035990  TIM_sf  
IPR000652  Triosephosphate_isomerase  
Gene Ontology GO:0004807  F:triose-phosphate isomerase activity  
GO:0006094  P:gluconeogenesis  
GO:0006096  P:glycolytic process  
Pfam View protein in Pfam  
PF00121  TIM  
PROSITE View protein in PROSITE  
PS51440  TIM_2  
Amino Acid Sequences MYFSLSRNRDATKRFLDCLSRASVESLSSVDILITPDFVALTGTIEQLKSSNVPVWPGAQDCHWEDDGAFTGEVSPAVLSETGVKIVGVGHAERRRPSATMTRRLPRRRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.48
4 0.43
5 0.43
6 0.39
7 0.32
8 0.28
9 0.27
10 0.24
11 0.19
12 0.18
13 0.15
14 0.11
15 0.1
16 0.09
17 0.07
18 0.07
19 0.08
20 0.07
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.06
37 0.07
38 0.09
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.11
45 0.11
46 0.09
47 0.11
48 0.11
49 0.14
50 0.13
51 0.12
52 0.11
53 0.12
54 0.13
55 0.11
56 0.1
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.05
63 0.03
64 0.04
65 0.05
66 0.04
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.08
77 0.16
78 0.21
79 0.25
80 0.27
81 0.31
82 0.32
83 0.31
84 0.36
85 0.38
86 0.43
87 0.49
88 0.56
89 0.62
90 0.7
91 0.78