FuNGI

Q5KJQ5

Protein Details

Accession

Q5KJQ5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
53-74	EEEEIKKTKRILRRMRIQIWAG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 23, E.R. 3

Family & Domain DBs

InterPro	View protein in InterPro IPR004923 FTR1/Fip1/EfeU
Gene Ontology	GO:0033573 C:high-affinity iron permease complex GO:0005886 C:plasma membrane GO:0015093 F:ferrous iron transmembrane transporter activity GO:0034755 P:iron ion transmembrane transport
Pfam	View protein in Pfam PF03239 FTR1

Amino Acid Sequences

MAKDLFSVTIFFIVFRETVEAAIIVSVLLSFVEQLMASGGPKKDDAQVQHLSEEEEIKKTKRILRRMRIQIWAGTLTGFIIAVAVGAAFIAVWYTTLTDLWANTEELWEGIFSLIACIIIYVMGLTFLKMDQSRVKWRIKLSEAFAHRAGKALFSFGGNKEDGEPDRPLTEEELAEEQAMKKKARSGKYAIFFLPFITVIREGLEAIVFVGGVSLGQDGASIPIAAIVGLIAGIFVGWCIYRTGSTLALHWFLIVSTCFLFLIGSGLFSKGVYDFEYYRFSSAVGGDVAESGNGPGSFQVAGNVWHLEYGNPEPGAVGTNGGWQIFNAILGWNNTASLGSILSYCFYWIAVIVGLAVMKWHEGRFTIFGRGSKAHGRIQARAEIKRAAEGQVSEGSEKDEGASEEGTARDTTHLNKNGDSPEDSLTPMIENSL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.12
2	0.11
3	0.14
4	0.12
5	0.12
6	0.12
7	0.12
8	0.1
9	0.1
10	0.09
11	0.05
12	0.05
13	0.04
14	0.04
15	0.03
16	0.03
17	0.03
18	0.04
19	0.05
20	0.04
21	0.05
22	0.06
23	0.07
24	0.07
25	0.13
26	0.14
27	0.15
28	0.16
29	0.18
30	0.22
31	0.27
32	0.31
33	0.32
34	0.39
35	0.38
36	0.38
37	0.37
38	0.34
39	0.29
40	0.3
41	0.25
42	0.23
43	0.25
44	0.26
45	0.3
46	0.35
47	0.41
48	0.45
49	0.54
50	0.6
51	0.67
52	0.75
53	0.81
54	0.81
55	0.8
56	0.74
57	0.66
58	0.59
59	0.5
60	0.39
61	0.29
62	0.23
63	0.16
64	0.13
65	0.09
66	0.06
67	0.04
68	0.04
69	0.03
70	0.03
71	0.03
72	0.02
73	0.02
74	0.02
75	0.02
76	0.02
77	0.02
78	0.02
79	0.03
80	0.03
81	0.04
82	0.05
83	0.05
84	0.06
85	0.07
86	0.07
87	0.09
88	0.11
89	0.11
90	0.1
91	0.11
92	0.1
93	0.09
94	0.1
95	0.07
96	0.06
97	0.05
98	0.05
99	0.05
100	0.05
101	0.05
102	0.05
103	0.05
104	0.04
105	0.04
106	0.03
107	0.03
108	0.03
109	0.03
110	0.04
111	0.04
112	0.04
113	0.04
114	0.05
115	0.08
116	0.08
117	0.11
118	0.15
119	0.2
120	0.3
121	0.36
122	0.41
123	0.43
124	0.46
125	0.51
126	0.51
127	0.5
128	0.46
129	0.47
130	0.45
131	0.45
132	0.44
133	0.38
134	0.33
135	0.31
136	0.27
137	0.21
138	0.18
139	0.15
140	0.13
141	0.12
142	0.15
143	0.13
144	0.16
145	0.14
146	0.14
147	0.14
148	0.17
149	0.17
150	0.17
151	0.17
152	0.15
153	0.15
154	0.16
155	0.15
156	0.14
157	0.14
158	0.11
159	0.11
160	0.12
161	0.11
162	0.11
163	0.11
164	0.1
165	0.14
166	0.17
167	0.16
168	0.16
169	0.21
170	0.28
171	0.33
172	0.37
173	0.38
174	0.42
175	0.46
176	0.47
177	0.42
178	0.36
179	0.32
180	0.26
181	0.21
182	0.14
183	0.1
184	0.09
185	0.08
186	0.07
187	0.08
188	0.08
189	0.07
190	0.07
191	0.06
192	0.04
193	0.04
194	0.04
195	0.03
196	0.03
197	0.02
198	0.02
199	0.02
200	0.02
201	0.02
202	0.02
203	0.02
204	0.02
205	0.02
206	0.03
207	0.03
208	0.03
209	0.03
210	0.03
211	0.03
212	0.03
213	0.03
214	0.02
215	0.02
216	0.02
217	0.02
218	0.02
219	0.01
220	0.01
221	0.01
222	0.01
223	0.02
224	0.02
225	0.03
226	0.04
227	0.04
228	0.05
229	0.06
230	0.08
231	0.1
232	0.1
233	0.11
234	0.12
235	0.13
236	0.13
237	0.11
238	0.1
239	0.07
240	0.08
241	0.07
242	0.06
243	0.05
244	0.06
245	0.06
246	0.06
247	0.06
248	0.05
249	0.06
250	0.05
251	0.06
252	0.06
253	0.06
254	0.06
255	0.06
256	0.07
257	0.06
258	0.07
259	0.07
260	0.09
261	0.1
262	0.12
263	0.16
264	0.16
265	0.16
266	0.16
267	0.14
268	0.13
269	0.12
270	0.12
271	0.08
272	0.08
273	0.07
274	0.07
275	0.07
276	0.06
277	0.05
278	0.04
279	0.06
280	0.05
281	0.05
282	0.05
283	0.06
284	0.07
285	0.06
286	0.08
287	0.07
288	0.08
289	0.1
290	0.1
291	0.09
292	0.09
293	0.1
294	0.09
295	0.11
296	0.12
297	0.14
298	0.14
299	0.14
300	0.13
301	0.13
302	0.15
303	0.12
304	0.1
305	0.07
306	0.1
307	0.11
308	0.11
309	0.11
310	0.09
311	0.1
312	0.09
313	0.09
314	0.06
315	0.06
316	0.08
317	0.09
318	0.1
319	0.09
320	0.09
321	0.09
322	0.09
323	0.09
324	0.07
325	0.06
326	0.05
327	0.06
328	0.06
329	0.07
330	0.07
331	0.07
332	0.06
333	0.06
334	0.06
335	0.06
336	0.06
337	0.06
338	0.05
339	0.05
340	0.05
341	0.05
342	0.05
343	0.05
344	0.04
345	0.05
346	0.07
347	0.07
348	0.08
349	0.1
350	0.13
351	0.17
352	0.19
353	0.24
354	0.26
355	0.28
356	0.31
357	0.32
358	0.33
359	0.36
360	0.38
361	0.37
362	0.41
363	0.43
364	0.44
365	0.46
366	0.5
367	0.49
368	0.48
369	0.46
370	0.43
371	0.41
372	0.4
373	0.37
374	0.31
375	0.29
376	0.26
377	0.26
378	0.26
379	0.27
380	0.22
381	0.21
382	0.21
383	0.18
384	0.17
385	0.15
386	0.12
387	0.12
388	0.14
389	0.14
390	0.12
391	0.14
392	0.14
393	0.15
394	0.13
395	0.13
396	0.13
397	0.15
398	0.2
399	0.28
400	0.35
401	0.36
402	0.37
403	0.42
404	0.44
405	0.46
406	0.43
407	0.36
408	0.32
409	0.31
410	0.3
411	0.25
412	0.22
413	0.19

Q5KJQ5

3D AlphaFold-predicted Structure Viewer