Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KDP7

Protein Details
Accession Q5KDP7    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
162-184VQPQKRRAPASKPRNTRPAKKTAHydrophilic
NLS Segment(s)
PositionSequence
18-35KAKPRRSRQGGAGARRGG
166-182KRRAPASKPRNTRPAKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003729  F:mRNA binding  
KEGG cne:CNG03240  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MASKMDIDRPLDEIIATKAKPRRSRQGGAGARRGGAASGATSARARYASTVPKTISAPQPFSAEVFKIIISNLPSDVTEAAVRDLMQSTVGPVKSVQMSYTATGKSTGIATVVFRNKGDARKAHASYHNRMIDNQRPMKVELAIDPNQAQSSLVNRVAPAPVQPQKRRAPASKPRNTRPAKKTAEQLDAEMAEYKQSSTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.2
4 0.24
5 0.28
6 0.37
7 0.46
8 0.52
9 0.59
10 0.62
11 0.69
12 0.69
13 0.75
14 0.75
15 0.74
16 0.74
17 0.64
18 0.55
19 0.49
20 0.42
21 0.31
22 0.23
23 0.15
24 0.08
25 0.09
26 0.09
27 0.1
28 0.1
29 0.1
30 0.11
31 0.11
32 0.11
33 0.11
34 0.17
35 0.24
36 0.27
37 0.31
38 0.3
39 0.32
40 0.33
41 0.35
42 0.37
43 0.33
44 0.33
45 0.31
46 0.32
47 0.3
48 0.29
49 0.26
50 0.19
51 0.16
52 0.13
53 0.11
54 0.1
55 0.09
56 0.1
57 0.1
58 0.1
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.08
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.05
75 0.06
76 0.09
77 0.09
78 0.09
79 0.08
80 0.1
81 0.1
82 0.11
83 0.1
84 0.09
85 0.1
86 0.1
87 0.12
88 0.11
89 0.1
90 0.11
91 0.11
92 0.09
93 0.08
94 0.08
95 0.06
96 0.06
97 0.06
98 0.11
99 0.13
100 0.13
101 0.13
102 0.16
103 0.19
104 0.22
105 0.26
106 0.24
107 0.28
108 0.35
109 0.37
110 0.39
111 0.44
112 0.46
113 0.46
114 0.52
115 0.51
116 0.43
117 0.44
118 0.46
119 0.45
120 0.48
121 0.48
122 0.43
123 0.4
124 0.41
125 0.4
126 0.35
127 0.29
128 0.23
129 0.25
130 0.23
131 0.22
132 0.21
133 0.2
134 0.19
135 0.18
136 0.15
137 0.1
138 0.12
139 0.15
140 0.16
141 0.16
142 0.16
143 0.17
144 0.18
145 0.17
146 0.17
147 0.2
148 0.25
149 0.34
150 0.39
151 0.46
152 0.53
153 0.61
154 0.66
155 0.64
156 0.68
157 0.69
158 0.76
159 0.78
160 0.79
161 0.79
162 0.82
163 0.84
164 0.84
165 0.8
166 0.8
167 0.78
168 0.73
169 0.74
170 0.71
171 0.71
172 0.62
173 0.56
174 0.5
175 0.43
176 0.39
177 0.32
178 0.25
179 0.19
180 0.18