Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KAN1

Protein Details
Accession Q5KAN1    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-25TPSRSRSRPLSSRSRTRSPYHydrophilic
284-309GPSGPARDRSRSPRRDRRESWSRRRDBasic
NLS Segment(s)
PositionSequence
281-309DRNGPSGPARDRSRSPRRDRRESWSRRRD
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Gene Ontology GO:0005634  C:nucleus  
KEGG cne:CNJ01110  -  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MPRSLTPSRSRSRPLSSRSRTRSPYSDRSPSPPPKGPRTPHLIRMFVTKGRHAPLADFDAGLFPTRDEFQVYAWQTSTPSELIKLLYPSFPAPYRSPQTRFHFRHVYVDASPRGLYRFKDLTSFIGRDLQSGSNDDSMDLDEDRELGRRGRKIEEKSLDDYGFVTGDFLSVSINVPEPRHPVNSLAAGALAGIAGNSSAGPAGLRDREGPRGGFGWGDRGGDRERPQRAVAPSSAPGEGSDATRWGRGVPLPPQDRTGPRGGRGGYERASLPEGRWNRGDDRNGPSGPARDRSRSPRRDRRESWSRRRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.74
4 0.78
5 0.79
6 0.81
7 0.77
8 0.75
9 0.77
10 0.75
11 0.75
12 0.73
13 0.74
14 0.69
15 0.69
16 0.72
17 0.71
18 0.71
19 0.69
20 0.68
21 0.68
22 0.74
23 0.74
24 0.71
25 0.71
26 0.68
27 0.69
28 0.69
29 0.62
30 0.53
31 0.55
32 0.52
33 0.48
34 0.46
35 0.41
36 0.38
37 0.38
38 0.4
39 0.34
40 0.31
41 0.3
42 0.32
43 0.28
44 0.24
45 0.21
46 0.19
47 0.18
48 0.18
49 0.14
50 0.08
51 0.09
52 0.11
53 0.11
54 0.12
55 0.12
56 0.12
57 0.2
58 0.22
59 0.21
60 0.21
61 0.21
62 0.19
63 0.2
64 0.2
65 0.13
66 0.11
67 0.11
68 0.11
69 0.12
70 0.13
71 0.15
72 0.14
73 0.14
74 0.15
75 0.14
76 0.16
77 0.17
78 0.19
79 0.2
80 0.26
81 0.31
82 0.37
83 0.4
84 0.46
85 0.52
86 0.59
87 0.6
88 0.61
89 0.62
90 0.57
91 0.59
92 0.52
93 0.48
94 0.39
95 0.4
96 0.34
97 0.27
98 0.27
99 0.2
100 0.2
101 0.19
102 0.18
103 0.19
104 0.2
105 0.19
106 0.22
107 0.22
108 0.24
109 0.26
110 0.26
111 0.21
112 0.24
113 0.23
114 0.21
115 0.23
116 0.2
117 0.16
118 0.17
119 0.18
120 0.13
121 0.14
122 0.13
123 0.11
124 0.1
125 0.1
126 0.08
127 0.07
128 0.05
129 0.06
130 0.06
131 0.07
132 0.08
133 0.1
134 0.14
135 0.16
136 0.19
137 0.24
138 0.3
139 0.33
140 0.41
141 0.43
142 0.43
143 0.43
144 0.43
145 0.38
146 0.31
147 0.27
148 0.19
149 0.14
150 0.1
151 0.08
152 0.04
153 0.04
154 0.04
155 0.04
156 0.03
157 0.04
158 0.04
159 0.04
160 0.06
161 0.07
162 0.08
163 0.1
164 0.13
165 0.15
166 0.17
167 0.17
168 0.17
169 0.18
170 0.19
171 0.18
172 0.14
173 0.12
174 0.1
175 0.09
176 0.07
177 0.04
178 0.03
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.03
188 0.03
189 0.06
190 0.07
191 0.08
192 0.12
193 0.14
194 0.19
195 0.21
196 0.21
197 0.2
198 0.2
199 0.19
200 0.17
201 0.15
202 0.15
203 0.14
204 0.15
205 0.14
206 0.16
207 0.17
208 0.22
209 0.27
210 0.29
211 0.32
212 0.33
213 0.35
214 0.39
215 0.4
216 0.38
217 0.35
218 0.31
219 0.3
220 0.3
221 0.28
222 0.22
223 0.19
224 0.17
225 0.16
226 0.14
227 0.12
228 0.13
229 0.13
230 0.14
231 0.14
232 0.12
233 0.14
234 0.15
235 0.19
236 0.23
237 0.32
238 0.35
239 0.37
240 0.4
241 0.43
242 0.44
243 0.43
244 0.46
245 0.4
246 0.38
247 0.43
248 0.4
249 0.4
250 0.41
251 0.41
252 0.34
253 0.33
254 0.31
255 0.28
256 0.3
257 0.26
258 0.23
259 0.27
260 0.29
261 0.3
262 0.33
263 0.34
264 0.37
265 0.43
266 0.48
267 0.46
268 0.49
269 0.52
270 0.49
271 0.47
272 0.45
273 0.44
274 0.43
275 0.45
276 0.44
277 0.43
278 0.51
279 0.59
280 0.66
281 0.7
282 0.76
283 0.78
284 0.83
285 0.87
286 0.86
287 0.85
288 0.86
289 0.86