Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WRS9

Protein Details
Accession A0A0B2WRS9    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-38GMRKNGKQWHEQKKAFRPTKBasic
69-118ATRKEKIDKIREKRAKKEEKARYEKMAETMHRKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
29-114EQKKAFRPTKGLTTFEKRAKERAVMAQMKEKEKEMKEEKEATRKEKIDKIREKRAKKEEKARYEKMAETMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSDNEAPSLVPAGPTKTLGMRKNGKQWHEQKKAFRPTKGLTTFEKRAKERAVMAQMKEKEKEMKEEKEATRKEKIDKIREKRAKKEEKARYEKMAETMHRKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.21
4 0.28
5 0.3
6 0.38
7 0.43
8 0.47
9 0.55
10 0.61
11 0.59
12 0.61
13 0.67
14 0.7
15 0.72
16 0.72
17 0.72
18 0.75
19 0.82
20 0.78
21 0.71
22 0.66
23 0.59
24 0.63
25 0.58
26 0.51
27 0.46
28 0.47
29 0.51
30 0.5
31 0.54
32 0.45
33 0.46
34 0.44
35 0.41
36 0.36
37 0.35
38 0.38
39 0.35
40 0.34
41 0.37
42 0.38
43 0.38
44 0.36
45 0.32
46 0.29
47 0.26
48 0.33
49 0.31
50 0.31
51 0.33
52 0.4
53 0.41
54 0.45
55 0.47
56 0.44
57 0.45
58 0.45
59 0.45
60 0.44
61 0.5
62 0.51
63 0.59
64 0.62
65 0.66
66 0.73
67 0.75
68 0.78
69 0.8
70 0.8
71 0.79
72 0.81
73 0.8
74 0.82
75 0.85
76 0.8
77 0.75
78 0.68
79 0.62
80 0.57
81 0.53
82 0.47
83 0.48
84 0.51
85 0.53
86 0.56
87 0.56
88 0.58
89 0.62
90 0.68
91 0.69
92 0.73
93 0.76
94 0.79
95 0.89
96 0.92
97 0.93
98 0.93