Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2X5R4

Protein Details
Accession A0A0B2X5R4    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-52VTPEEPLKRRLRPRRGKTEEASBasic
70-91RPSSSSIKVKPKPRKTLIRLHGHydrophilic
NLS Segment(s)
PositionSequence
38-46KRRLRPRRG
77-85KVKPKPRKT
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVAVQMPADPSSLNNVSMYGFGAIPNLEASVTPEEPLKRRLRPRRGKTEEASDADVFLVNVRQRSNGNQRPSSSSIKVKPKPRKTLIRLHGSAKAQPGSKHLPIEILDSEKKAAGSDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.16
5 0.16
6 0.1
7 0.09
8 0.08
9 0.08
10 0.08
11 0.08
12 0.08
13 0.07
14 0.06
15 0.05
16 0.08
17 0.12
18 0.12
19 0.12
20 0.15
21 0.17
22 0.19
23 0.27
24 0.3
25 0.33
26 0.43
27 0.53
28 0.62
29 0.71
30 0.78
31 0.82
32 0.83
33 0.83
34 0.76
35 0.73
36 0.68
37 0.59
38 0.53
39 0.41
40 0.34
41 0.27
42 0.24
43 0.15
44 0.1
45 0.1
46 0.07
47 0.08
48 0.08
49 0.1
50 0.11
51 0.17
52 0.27
53 0.32
54 0.38
55 0.4
56 0.41
57 0.46
58 0.5
59 0.49
60 0.43
61 0.42
62 0.43
63 0.5
64 0.55
65 0.59
66 0.65
67 0.69
68 0.76
69 0.78
70 0.81
71 0.77
72 0.81
73 0.79
74 0.78
75 0.72
76 0.65
77 0.63
78 0.55
79 0.52
80 0.46
81 0.41
82 0.34
83 0.32
84 0.35
85 0.35
86 0.37
87 0.36
88 0.31
89 0.31
90 0.29
91 0.32
92 0.29
93 0.27
94 0.25
95 0.25
96 0.26
97 0.24
98 0.23