Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P0CQ30

Protein Details
Accession P0CQ30    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
58-77LGLSLKKKRKCRIVPPEWLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 6, mito 1, plas 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR021151  GINS_A  
IPR036224  GINS_bundle-like_dom_sf  
IPR007257  GINS_Psf2  
Gene Ontology GO:0000785  C:chromatin  
GO:0071162  C:CMG complex  
GO:0000811  C:GINS complex  
GO:0031298  C:replication fork protection complex  
GO:0007059  P:chromosome segregation  
GO:0006268  P:DNA unwinding involved in DNA replication  
GO:0000727  P:double-strand break repair via break-induced replication  
GO:1902969  P:mitotic DNA replication  
Pfam View protein in Pfam  
PF05916  Sld5  
CDD cd11712  GINS_A_psf2  
cd21694  GINS_B_Psf2  
Amino Acid Sequences MALPKTLHPALTPDELAFLAEHDHISIVPLFSMTRVRLISGIYGPFRPPSASRVPLWLGLSLKKKRKCRIVPPEWLSAERLQAFLRDEKENSEGFERLPRRFMEISKVLLDIASDDLSQPTLLRSLLKDIREVRQAKIRMGLQSEDVLQNDYLQVMPFSSLCPVALRRHLTRYGIGDQSHSLGTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.16
5 0.12
6 0.1
7 0.09
8 0.09
9 0.08
10 0.08
11 0.07
12 0.09
13 0.1
14 0.08
15 0.08
16 0.08
17 0.08
18 0.09
19 0.13
20 0.11
21 0.14
22 0.14
23 0.15
24 0.15
25 0.16
26 0.17
27 0.16
28 0.19
29 0.17
30 0.17
31 0.18
32 0.18
33 0.18
34 0.18
35 0.16
36 0.19
37 0.24
38 0.26
39 0.26
40 0.29
41 0.3
42 0.31
43 0.31
44 0.28
45 0.22
46 0.24
47 0.32
48 0.35
49 0.42
50 0.47
51 0.54
52 0.59
53 0.68
54 0.71
55 0.74
56 0.77
57 0.77
58 0.8
59 0.77
60 0.76
61 0.67
62 0.59
63 0.5
64 0.4
65 0.34
66 0.24
67 0.21
68 0.14
69 0.14
70 0.14
71 0.15
72 0.17
73 0.16
74 0.15
75 0.16
76 0.19
77 0.18
78 0.17
79 0.16
80 0.14
81 0.12
82 0.19
83 0.19
84 0.18
85 0.2
86 0.19
87 0.23
88 0.24
89 0.24
90 0.24
91 0.24
92 0.26
93 0.24
94 0.24
95 0.18
96 0.17
97 0.16
98 0.1
99 0.08
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.06
107 0.05
108 0.06
109 0.06
110 0.07
111 0.08
112 0.14
113 0.19
114 0.19
115 0.24
116 0.26
117 0.29
118 0.37
119 0.38
120 0.34
121 0.38
122 0.39
123 0.36
124 0.39
125 0.38
126 0.33
127 0.33
128 0.32
129 0.25
130 0.24
131 0.25
132 0.21
133 0.18
134 0.17
135 0.14
136 0.14
137 0.12
138 0.11
139 0.1
140 0.08
141 0.08
142 0.06
143 0.07
144 0.07
145 0.08
146 0.09
147 0.09
148 0.09
149 0.12
150 0.15
151 0.19
152 0.26
153 0.32
154 0.34
155 0.4
156 0.45
157 0.45
158 0.46
159 0.46
160 0.45
161 0.43
162 0.4
163 0.37
164 0.33
165 0.33