FuNGI

P0CO60

Protein Details

Accession

P0CO60

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
88-112	VLEIRTRKKLIRRPKVRPPRIISWA	Hydrophilic

NLS Segment(s)

Position	Sequence
93-107	TRKKLIRRPKVRPPR
482-486	RGPKR

Subcellular Location(s)

extr 14, cyto 5.5, mito 5, cyto_nucl 4

Family & Domain DBs

InterPro	View protein in InterPro IPR029058 AB_hydrolase IPR002921 Fungal_lipase-like
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane GO:0000139 C:Golgi membrane GO:0032585 C:multivesicular body membrane GO:0005775 C:vacuolar lumen GO:0004620 F:phospholipase activity GO:0004806 F:triglyceride lipase activity GO:0016236 P:macroautophagy GO:0034496 P:multivesicular body membrane disassembly GO:0046461 P:neutral lipid catabolic process GO:0000425 P:pexophagy GO:0006660 P:phosphatidylserine catabolic process GO:0034727 P:piecemeal microautophagy of the nucleus GO:0006624 P:vacuolar protein processing
KEGG	cne:CNC01140 -
Pfam	View protein in Pfam PF01764 Lipase_3
PROSITE	View protein in PROSITE PS00120 LIPASE_SER
CDD	cd00519 Lipase_3

Amino Acid Sequences

MYIPGPLRLSSYLLPFLSSPSPPAQSSPDTRTISFKPVHAHGHAFVDNASTPTLLFLDQSPSASLYAHDYPIGAFGDDYVLPRLTSDVLEIRTRKKLIRRPKVRPPRIISWAQSYRAQALHFNGINNNNDNSNKSISLPESWLAPDLANPSDEWSDVEVTVPDLTDRQTVITLAKMSSNAYVTPGGAGWYTLNDWNASMPFGWEPDADGLRGHVFADEKNETVIISIKGTSAGVLGSGGPTAKNDKFNDNLLFSCCCARVDFSWTPVCDCYAGGYKCGQTCLEDALVSESVYATVGTNLYNNITYMYPNATIWLTGHSLGGAVSSLIGLSFGAPAVTYESPGELLPASRLHLPLPPGMPANLSGITHVYHTADPIAMGVCNGPYSSCYAAGFAMESKCHTGETILYDTVRVKGWSVDVRTHRIEEVIDKVLADPWPEEGEGKSGVWEKAVEGWYRAADRVRAALDESVVRDDVNVWWGWGRRGPKRQPGGEDPGWRKHGGVPKPVSEEDCVDCYKWEFGEWN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.27
2	0.24
3	0.26
4	0.26
5	0.24
6	0.23
7	0.23
8	0.26
9	0.26
10	0.28
11	0.3
12	0.32
13	0.38
14	0.41
15	0.45
16	0.45
17	0.46
18	0.49
19	0.47
20	0.49
21	0.45
22	0.42
23	0.38
24	0.4
25	0.45
26	0.42
27	0.42
28	0.37
29	0.4
30	0.38
31	0.32
32	0.27
33	0.24
34	0.21
35	0.19
36	0.17
37	0.11
38	0.1
39	0.11
40	0.11
41	0.09
42	0.09
43	0.09
44	0.13
45	0.14
46	0.15
47	0.15
48	0.16
49	0.16
50	0.15
51	0.14
52	0.15
53	0.17
54	0.17
55	0.16
56	0.15
57	0.14
58	0.17
59	0.17
60	0.11
61	0.09
62	0.08
63	0.11
64	0.11
65	0.12
66	0.12
67	0.12
68	0.12
69	0.12
70	0.13
71	0.11
72	0.11
73	0.12
74	0.14
75	0.16
76	0.23
77	0.26
78	0.29
79	0.35
80	0.37
81	0.4
82	0.45
83	0.52
84	0.57
85	0.66
86	0.72
87	0.74
88	0.83
89	0.89
90	0.89
91	0.89
92	0.86
93	0.83
94	0.79
95	0.76
96	0.68
97	0.66
98	0.63
99	0.56
100	0.52
101	0.45
102	0.41
103	0.37
104	0.34
105	0.28
106	0.25
107	0.29
108	0.27
109	0.26
110	0.28
111	0.3
112	0.32
113	0.32
114	0.3
115	0.26
116	0.25
117	0.26
118	0.25
119	0.24
120	0.21
121	0.2
122	0.21
123	0.2
124	0.21
125	0.21
126	0.18
127	0.17
128	0.17
129	0.17
130	0.14
131	0.12
132	0.12
133	0.12
134	0.12
135	0.11
136	0.11
137	0.12
138	0.12
139	0.13
140	0.12
141	0.11
142	0.11
143	0.11
144	0.11
145	0.09
146	0.09
147	0.09
148	0.08
149	0.07
150	0.06
151	0.07
152	0.08
153	0.08
154	0.08
155	0.08
156	0.09
157	0.1
158	0.11
159	0.11
160	0.1
161	0.11
162	0.11
163	0.11
164	0.12
165	0.12
166	0.1
167	0.11
168	0.11
169	0.1
170	0.1
171	0.09
172	0.08
173	0.07
174	0.07
175	0.05
176	0.06
177	0.07
178	0.08
179	0.09
180	0.08
181	0.08
182	0.09
183	0.09
184	0.09
185	0.07
186	0.07
187	0.07
188	0.07
189	0.08
190	0.07
191	0.08
192	0.1
193	0.1
194	0.09
195	0.09
196	0.09
197	0.09
198	0.09
199	0.08
200	0.07
201	0.07
202	0.07
203	0.12
204	0.12
205	0.12
206	0.12
207	0.12
208	0.11
209	0.11
210	0.12
211	0.08
212	0.07
213	0.07
214	0.07
215	0.08
216	0.08
217	0.07
218	0.05
219	0.05
220	0.04
221	0.04
222	0.04
223	0.03
224	0.04
225	0.04
226	0.03
227	0.04
228	0.09
229	0.11
230	0.16
231	0.18
232	0.2
233	0.22
234	0.26
235	0.27
236	0.24
237	0.23
238	0.19
239	0.19
240	0.16
241	0.16
242	0.13
243	0.11
244	0.1
245	0.11
246	0.1
247	0.16
248	0.17
249	0.18
250	0.21
251	0.21
252	0.22
253	0.2
254	0.2
255	0.13
256	0.12
257	0.11
258	0.15
259	0.15
260	0.15
261	0.16
262	0.17
263	0.17
264	0.19
265	0.17
266	0.11
267	0.11
268	0.12
269	0.11
270	0.09
271	0.09
272	0.1
273	0.1
274	0.09
275	0.08
276	0.06
277	0.06
278	0.06
279	0.06
280	0.04
281	0.04
282	0.04
283	0.05
284	0.05
285	0.05
286	0.06
287	0.06
288	0.06
289	0.07
290	0.07
291	0.07
292	0.08
293	0.09
294	0.09
295	0.09
296	0.1
297	0.09
298	0.08
299	0.09
300	0.1
301	0.09
302	0.09
303	0.09
304	0.07
305	0.07
306	0.07
307	0.07
308	0.04
309	0.03
310	0.03
311	0.03
312	0.03
313	0.02
314	0.03
315	0.02
316	0.03
317	0.03
318	0.03
319	0.03
320	0.03
321	0.03
322	0.07
323	0.07
324	0.08
325	0.08
326	0.08
327	0.09
328	0.09
329	0.09
330	0.06
331	0.06
332	0.07
333	0.08
334	0.09
335	0.1
336	0.11
337	0.11
338	0.13
339	0.15
340	0.16
341	0.17
342	0.17
343	0.16
344	0.16
345	0.15
346	0.14
347	0.15
348	0.13
349	0.12
350	0.11
351	0.11
352	0.11
353	0.11
354	0.11
355	0.1
356	0.09
357	0.09
358	0.1
359	0.09
360	0.08
361	0.08
362	0.08
363	0.06
364	0.06
365	0.06
366	0.05
367	0.05
368	0.05
369	0.05
370	0.05
371	0.09
372	0.1
373	0.11
374	0.11
375	0.11
376	0.11
377	0.11
378	0.11
379	0.11
380	0.11
381	0.1
382	0.11
383	0.13
384	0.13
385	0.13
386	0.12
387	0.11
388	0.12
389	0.16
390	0.18
391	0.17
392	0.17
393	0.18
394	0.18
395	0.19
396	0.19
397	0.14
398	0.12
399	0.12
400	0.17
401	0.21
402	0.23
403	0.29
404	0.32
405	0.38
406	0.4
407	0.4
408	0.36
409	0.31
410	0.29
411	0.25
412	0.25
413	0.22
414	0.2
415	0.18
416	0.18
417	0.2
418	0.2
419	0.18
420	0.13
421	0.12
422	0.14
423	0.14
424	0.14
425	0.12
426	0.14
427	0.14
428	0.14
429	0.15
430	0.17
431	0.17
432	0.17
433	0.17
434	0.15
435	0.2
436	0.23
437	0.21
438	0.19
439	0.21
440	0.23
441	0.24
442	0.25
443	0.22
444	0.21
445	0.21
446	0.23
447	0.22
448	0.21
449	0.21
450	0.2
451	0.19
452	0.19
453	0.19
454	0.18
455	0.17
456	0.16
457	0.14
458	0.14
459	0.14
460	0.15
461	0.13
462	0.11
463	0.15
464	0.17
465	0.19
466	0.23
467	0.3
468	0.36
469	0.47
470	0.55
471	0.62
472	0.7
473	0.74
474	0.76
475	0.77
476	0.76
477	0.73
478	0.74
479	0.7
480	0.69
481	0.66
482	0.59
483	0.52
484	0.5
485	0.51
486	0.49
487	0.53
488	0.5
489	0.52
490	0.58
491	0.59
492	0.55
493	0.49
494	0.46
495	0.39
496	0.37
497	0.33
498	0.27
499	0.27
500	0.27
501	0.26
502	0.23

P0CO60

3D AlphaFold-predicted Structure Viewer