Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WXM7

Protein Details
Accession A0A0B2WXM7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-61ASSAVRPPSPKRQARKPKPIKRFVPDEVHydrophilic
NLS Segment(s)
PositionSequence
39-56RPPSPKRQARKPKPIKRF
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MAIATALVRPLVPRSPLLRSSYLSWSSTSAQRPASSAVRPPSPKRQARKPKPIKRFVPDEVKKFVKPDGKLLTTPQNRDFLLQHGLEPDNGRMTLLHGGPELSRAASDFSAMLAYSPRHIIHPFDLRYFEPRGHPLAPMKRAKYAHKTRHEPMWIMVSCAGNASAVVRTLTRRRLTRCIYEALHGLGYRAGSRNGEVSKVWGTLWVVVHDPVKAATQSPERFGRVVADALVKNCRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.36
4 0.4
5 0.4
6 0.39
7 0.41
8 0.44
9 0.43
10 0.38
11 0.34
12 0.32
13 0.32
14 0.35
15 0.35
16 0.31
17 0.31
18 0.3
19 0.31
20 0.33
21 0.34
22 0.3
23 0.33
24 0.33
25 0.38
26 0.43
27 0.47
28 0.53
29 0.59
30 0.65
31 0.67
32 0.73
33 0.77
34 0.82
35 0.88
36 0.88
37 0.88
38 0.91
39 0.93
40 0.9
41 0.85
42 0.82
43 0.77
44 0.77
45 0.73
46 0.68
47 0.64
48 0.6
49 0.54
50 0.48
51 0.47
52 0.42
53 0.37
54 0.4
55 0.4
56 0.39
57 0.39
58 0.41
59 0.45
60 0.43
61 0.46
62 0.41
63 0.38
64 0.35
65 0.36
66 0.34
67 0.26
68 0.26
69 0.22
70 0.19
71 0.18
72 0.19
73 0.18
74 0.18
75 0.15
76 0.12
77 0.12
78 0.11
79 0.09
80 0.1
81 0.12
82 0.11
83 0.11
84 0.09
85 0.1
86 0.1
87 0.11
88 0.1
89 0.06
90 0.06
91 0.06
92 0.07
93 0.06
94 0.07
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.07
104 0.07
105 0.09
106 0.09
107 0.11
108 0.13
109 0.2
110 0.21
111 0.21
112 0.22
113 0.22
114 0.25
115 0.24
116 0.22
117 0.17
118 0.18
119 0.21
120 0.19
121 0.21
122 0.24
123 0.28
124 0.34
125 0.38
126 0.37
127 0.4
128 0.42
129 0.46
130 0.5
131 0.54
132 0.57
133 0.6
134 0.66
135 0.62
136 0.67
137 0.64
138 0.55
139 0.46
140 0.45
141 0.36
142 0.3
143 0.3
144 0.22
145 0.19
146 0.18
147 0.17
148 0.08
149 0.08
150 0.08
151 0.06
152 0.06
153 0.07
154 0.07
155 0.11
156 0.16
157 0.23
158 0.28
159 0.34
160 0.39
161 0.47
162 0.52
163 0.56
164 0.55
165 0.54
166 0.49
167 0.46
168 0.42
169 0.35
170 0.31
171 0.23
172 0.2
173 0.15
174 0.14
175 0.13
176 0.14
177 0.14
178 0.13
179 0.14
180 0.18
181 0.18
182 0.2
183 0.18
184 0.2
185 0.2
186 0.2
187 0.19
188 0.17
189 0.16
190 0.19
191 0.2
192 0.18
193 0.17
194 0.18
195 0.19
196 0.17
197 0.17
198 0.14
199 0.15
200 0.14
201 0.14
202 0.18
203 0.26
204 0.28
205 0.33
206 0.37
207 0.37
208 0.37
209 0.36
210 0.34
211 0.27
212 0.26
213 0.23
214 0.24
215 0.23
216 0.25