Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WUK1

Protein Details
Accession A0A0B2WUK1   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-69LALLPKDKKRDNPGRRRPERRGGAABasic
NLS Segment(s)
PositionSequence
50-66KDKKRDNPGRRRPERRG
Subcellular Location(s) nucl 7cysk 7, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR002993  ODC_AZ  
IPR038581  ODC_AZ_sf  
Gene Ontology GO:0008073  F:ornithine decarboxylase inhibitor activity  
Pfam View protein in Pfam  
PF02100  ODC_AZ  
Amino Acid Sequences MIVISSTPMLTNVQGRSGIPEVPTSGLPSPPTSPPLAALTSSNELALLPKDKKRDNPGRRRPERRGGAALMIREECERFFCESMKAVFHGERNLSMDGSGLSGAYLQTPPLEDPLLDVFRQRMDIKSRGFEVDAWMEVWDYAGGASFRAFVASNGQERSLFVFFDIEGVVGRDLKKALMALIELADGPLNCAHIVTCVDRRIPLEEAHELTKSLQWVGFEITTLDHWANNLDVTSKRWVFMGMEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.23
4 0.24
5 0.24
6 0.2
7 0.2
8 0.19
9 0.2
10 0.2
11 0.19
12 0.19
13 0.19
14 0.19
15 0.21
16 0.22
17 0.23
18 0.25
19 0.24
20 0.22
21 0.22
22 0.24
23 0.22
24 0.2
25 0.18
26 0.2
27 0.2
28 0.2
29 0.18
30 0.15
31 0.13
32 0.14
33 0.15
34 0.17
35 0.18
36 0.22
37 0.29
38 0.33
39 0.4
40 0.5
41 0.58
42 0.63
43 0.71
44 0.77
45 0.82
46 0.89
47 0.91
48 0.89
49 0.88
50 0.85
51 0.79
52 0.73
53 0.64
54 0.6
55 0.53
56 0.45
57 0.37
58 0.29
59 0.24
60 0.2
61 0.18
62 0.12
63 0.12
64 0.13
65 0.14
66 0.15
67 0.15
68 0.16
69 0.18
70 0.19
71 0.18
72 0.16
73 0.16
74 0.16
75 0.17
76 0.18
77 0.16
78 0.16
79 0.17
80 0.17
81 0.15
82 0.13
83 0.12
84 0.09
85 0.09
86 0.08
87 0.05
88 0.04
89 0.04
90 0.04
91 0.05
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.06
98 0.07
99 0.06
100 0.07
101 0.1
102 0.11
103 0.1
104 0.11
105 0.1
106 0.1
107 0.13
108 0.12
109 0.12
110 0.16
111 0.21
112 0.22
113 0.23
114 0.24
115 0.22
116 0.22
117 0.19
118 0.17
119 0.13
120 0.12
121 0.1
122 0.09
123 0.09
124 0.08
125 0.08
126 0.05
127 0.04
128 0.03
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.06
137 0.05
138 0.1
139 0.12
140 0.15
141 0.15
142 0.16
143 0.15
144 0.15
145 0.19
146 0.15
147 0.12
148 0.1
149 0.1
150 0.09
151 0.1
152 0.09
153 0.06
154 0.05
155 0.06
156 0.06
157 0.07
158 0.08
159 0.08
160 0.09
161 0.09
162 0.09
163 0.09
164 0.09
165 0.08
166 0.08
167 0.07
168 0.07
169 0.07
170 0.06
171 0.06
172 0.07
173 0.06
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.07
180 0.08
181 0.1
182 0.13
183 0.17
184 0.19
185 0.2
186 0.22
187 0.24
188 0.26
189 0.26
190 0.24
191 0.24
192 0.26
193 0.27
194 0.28
195 0.27
196 0.24
197 0.22
198 0.23
199 0.19
200 0.17
201 0.15
202 0.13
203 0.14
204 0.17
205 0.16
206 0.14
207 0.13
208 0.13
209 0.13
210 0.15
211 0.14
212 0.11
213 0.11
214 0.12
215 0.12
216 0.12
217 0.11
218 0.12
219 0.13
220 0.16
221 0.25
222 0.24
223 0.24
224 0.23
225 0.25