Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B2WZ63

Protein Details
Accession A0A0B2WZ63    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
264-294DRKRLLEKAKAKSRKSKKPNRSLHKGSNSGQBasic
NLS Segment(s)
PositionSequence
254-287KDRRHRREEADRKRLLEKAKAKSRKSKKPNRSLH
Subcellular Location(s) mito 14, nucl 10, plas 2
Family & Domain DBs
Amino Acid Sequences MTTTALREATSALMATRYRHRMLPAVIKASLGLVGEDWDVLGTVGPLFGHCQMPTPTGSVEARRLGQVIGRQPSQYLSLLLELHSNNKFITVSDSGGIISSAIANAGKLPQGQENVSLLQQHSSTPKSTPTSAQFTFTCDSQVPGTVQWPGNASRDDTVEQDPGMQSNGSPNNSTSNDVSQGATSRQASQSFRRTRPQLDRELKMAARHRRQIAAEKFEENPPKPEDMWICEFCEYERIFGQPPKVLIRAFEIKDRRHRREEADRKRLLEKAKAKSRKSKKPNRSLHKGSNSGQHHTDHMRSGYTDDHQASRMHLGHSHSTQSEEEYDEGLTDCCVHSQPCPEHQEGDGGGTDGQEEAVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.25
4 0.3
5 0.32
6 0.34
7 0.37
8 0.4
9 0.45
10 0.52
11 0.5
12 0.48
13 0.46
14 0.43
15 0.4
16 0.34
17 0.28
18 0.18
19 0.12
20 0.07
21 0.08
22 0.08
23 0.08
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.07
35 0.1
36 0.12
37 0.12
38 0.16
39 0.17
40 0.2
41 0.21
42 0.21
43 0.19
44 0.21
45 0.23
46 0.22
47 0.24
48 0.25
49 0.25
50 0.24
51 0.24
52 0.2
53 0.21
54 0.23
55 0.27
56 0.29
57 0.29
58 0.28
59 0.28
60 0.29
61 0.29
62 0.25
63 0.18
64 0.14
65 0.15
66 0.15
67 0.15
68 0.17
69 0.14
70 0.18
71 0.18
72 0.18
73 0.15
74 0.16
75 0.16
76 0.13
77 0.18
78 0.15
79 0.15
80 0.14
81 0.15
82 0.13
83 0.13
84 0.13
85 0.08
86 0.06
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.07
96 0.08
97 0.11
98 0.13
99 0.14
100 0.15
101 0.16
102 0.16
103 0.16
104 0.16
105 0.14
106 0.13
107 0.13
108 0.12
109 0.14
110 0.15
111 0.16
112 0.15
113 0.2
114 0.21
115 0.23
116 0.26
117 0.27
118 0.32
119 0.31
120 0.34
121 0.29
122 0.3
123 0.29
124 0.25
125 0.22
126 0.15
127 0.16
128 0.12
129 0.14
130 0.11
131 0.1
132 0.11
133 0.13
134 0.14
135 0.13
136 0.15
137 0.15
138 0.17
139 0.17
140 0.17
141 0.14
142 0.15
143 0.15
144 0.16
145 0.16
146 0.14
147 0.13
148 0.13
149 0.12
150 0.1
151 0.1
152 0.08
153 0.06
154 0.1
155 0.14
156 0.14
157 0.14
158 0.14
159 0.18
160 0.19
161 0.21
162 0.17
163 0.15
164 0.16
165 0.16
166 0.16
167 0.12
168 0.12
169 0.11
170 0.12
171 0.11
172 0.11
173 0.12
174 0.16
175 0.18
176 0.22
177 0.31
178 0.37
179 0.4
180 0.45
181 0.46
182 0.5
183 0.57
184 0.57
185 0.58
186 0.57
187 0.56
188 0.51
189 0.52
190 0.46
191 0.41
192 0.43
193 0.41
194 0.41
195 0.44
196 0.44
197 0.44
198 0.45
199 0.5
200 0.49
201 0.46
202 0.42
203 0.39
204 0.38
205 0.4
206 0.44
207 0.36
208 0.34
209 0.29
210 0.29
211 0.27
212 0.29
213 0.26
214 0.24
215 0.29
216 0.27
217 0.26
218 0.24
219 0.24
220 0.21
221 0.25
222 0.2
223 0.16
224 0.15
225 0.15
226 0.17
227 0.2
228 0.23
229 0.19
230 0.21
231 0.22
232 0.24
233 0.22
234 0.2
235 0.24
236 0.28
237 0.27
238 0.32
239 0.35
240 0.39
241 0.5
242 0.58
243 0.59
244 0.59
245 0.62
246 0.63
247 0.68
248 0.74
249 0.74
250 0.75
251 0.72
252 0.68
253 0.67
254 0.64
255 0.57
256 0.56
257 0.53
258 0.53
259 0.6
260 0.66
261 0.68
262 0.74
263 0.8
264 0.81
265 0.84
266 0.85
267 0.85
268 0.87
269 0.92
270 0.91
271 0.91
272 0.89
273 0.89
274 0.87
275 0.82
276 0.74
277 0.73
278 0.67
279 0.61
280 0.55
281 0.45
282 0.4
283 0.38
284 0.38
285 0.33
286 0.3
287 0.27
288 0.25
289 0.26
290 0.24
291 0.22
292 0.26
293 0.24
294 0.24
295 0.25
296 0.25
297 0.25
298 0.28
299 0.28
300 0.23
301 0.25
302 0.28
303 0.31
304 0.33
305 0.35
306 0.3
307 0.31
308 0.3
309 0.29
310 0.26
311 0.22
312 0.21
313 0.18
314 0.17
315 0.15
316 0.15
317 0.12
318 0.11
319 0.09
320 0.09
321 0.09
322 0.11
323 0.11
324 0.14
325 0.23
326 0.28
327 0.36
328 0.42
329 0.42
330 0.43
331 0.43
332 0.45
333 0.36
334 0.33
335 0.25
336 0.2
337 0.18
338 0.15
339 0.15
340 0.1