Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0B2X3L5

Protein Details
Accession A0A0B2X3L5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
487-512IGRPPWFVRVMKRHRRCRDEGGNTITHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045018  Azg-like  
IPR006043  NCS2  
Gene Ontology GO:0016020  C:membrane  
GO:0015205  F:nucleobase transmembrane transporter activity  
GO:1904823  P:purine nucleobase transmembrane transport  
Pfam View protein in Pfam  
PF00860  Xan_ur_permease  
Amino Acid Sequences MELRKFFRSIDLWVANSRFGSYFRLGDSDNPDKIDGASFCREIRAGLTTFATMAYIISVNVRRVPPYVRRELITATAAIAGLSSLVFGIVTNLPVALAPGMGLNAYFAFQVVGVNGDGKIPYQTALTAVFIEGIIFVVLALSGMRQWLVKLIPSTLKVATGVGIGFLLTEIGLSYSVGIGAITGGGRATPLALGGCPPELLSATTGMCESGQMTNPKLWLGVFCGGIVTAFLMAYRIKYSLVIGIALVSVISWPRNTPVTYFPDTDEGNSRFDFFKQIVAWHPMSKTLNQLDWTFSSGSSQFALALFTFLYVDIIDATATLYSMVRFCGVDDRKDGDFRRSTLAYCTDALFISIGALFGLSPVTAFIESGAGIAEGGRTGITAIVSGLCFLTSIFFAPVFASLPPWATGCTLIMITQVNWYYIGDVLPSFIVMTFIPFSYSVAYGLIAGIFVYTILNGLVGIIVHVSGGRIEPREYDLKEYWTWKGIGRPPWFVRVMKRHRRCRDEGGNTITSGSNGTDDMDGSSSMTRVKTISNDYSAANGGAKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.34
4 0.32
5 0.23
6 0.21
7 0.24
8 0.22
9 0.23
10 0.23
11 0.25
12 0.24
13 0.28
14 0.35
15 0.36
16 0.35
17 0.35
18 0.34
19 0.32
20 0.32
21 0.31
22 0.25
23 0.23
24 0.25
25 0.25
26 0.25
27 0.27
28 0.26
29 0.22
30 0.22
31 0.22
32 0.18
33 0.18
34 0.19
35 0.18
36 0.18
37 0.17
38 0.15
39 0.1
40 0.08
41 0.08
42 0.07
43 0.06
44 0.11
45 0.14
46 0.16
47 0.21
48 0.22
49 0.22
50 0.25
51 0.31
52 0.36
53 0.41
54 0.48
55 0.46
56 0.47
57 0.48
58 0.48
59 0.45
60 0.37
61 0.29
62 0.21
63 0.18
64 0.17
65 0.14
66 0.11
67 0.07
68 0.05
69 0.05
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.06
76 0.06
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06
98 0.05
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.07
105 0.08
106 0.09
107 0.08
108 0.08
109 0.08
110 0.08
111 0.09
112 0.1
113 0.1
114 0.09
115 0.09
116 0.08
117 0.08
118 0.08
119 0.06
120 0.05
121 0.04
122 0.04
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.04
133 0.04
134 0.08
135 0.08
136 0.11
137 0.12
138 0.15
139 0.18
140 0.19
141 0.22
142 0.19
143 0.19
144 0.16
145 0.16
146 0.13
147 0.11
148 0.09
149 0.06
150 0.06
151 0.05
152 0.04
153 0.04
154 0.04
155 0.03
156 0.03
157 0.02
158 0.03
159 0.03
160 0.03
161 0.04
162 0.03
163 0.04
164 0.04
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.04
180 0.05
181 0.05
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.06
195 0.06
196 0.06
197 0.07
198 0.1
199 0.12
200 0.13
201 0.14
202 0.15
203 0.15
204 0.14
205 0.12
206 0.09
207 0.11
208 0.12
209 0.11
210 0.1
211 0.1
212 0.1
213 0.09
214 0.09
215 0.05
216 0.03
217 0.03
218 0.03
219 0.04
220 0.04
221 0.05
222 0.06
223 0.06
224 0.06
225 0.07
226 0.07
227 0.08
228 0.08
229 0.08
230 0.07
231 0.06
232 0.06
233 0.06
234 0.05
235 0.03
236 0.03
237 0.03
238 0.04
239 0.04
240 0.04
241 0.06
242 0.08
243 0.09
244 0.11
245 0.15
246 0.21
247 0.24
248 0.25
249 0.24
250 0.25
251 0.25
252 0.24
253 0.24
254 0.2
255 0.18
256 0.17
257 0.18
258 0.16
259 0.16
260 0.17
261 0.12
262 0.13
263 0.12
264 0.13
265 0.14
266 0.18
267 0.19
268 0.18
269 0.18
270 0.19
271 0.2
272 0.2
273 0.22
274 0.19
275 0.2
276 0.2
277 0.2
278 0.18
279 0.18
280 0.19
281 0.15
282 0.13
283 0.13
284 0.11
285 0.11
286 0.1
287 0.09
288 0.07
289 0.07
290 0.08
291 0.06
292 0.06
293 0.05
294 0.05
295 0.05
296 0.05
297 0.05
298 0.04
299 0.04
300 0.03
301 0.04
302 0.03
303 0.03
304 0.04
305 0.03
306 0.03
307 0.04
308 0.04
309 0.04
310 0.04
311 0.05
312 0.05
313 0.05
314 0.06
315 0.15
316 0.16
317 0.18
318 0.2
319 0.24
320 0.24
321 0.29
322 0.3
323 0.27
324 0.28
325 0.28
326 0.3
327 0.27
328 0.27
329 0.26
330 0.28
331 0.23
332 0.21
333 0.2
334 0.16
335 0.15
336 0.15
337 0.12
338 0.08
339 0.07
340 0.06
341 0.05
342 0.04
343 0.04
344 0.03
345 0.03
346 0.03
347 0.03
348 0.03
349 0.03
350 0.04
351 0.04
352 0.04
353 0.04
354 0.05
355 0.05
356 0.05
357 0.05
358 0.04
359 0.04
360 0.04
361 0.04
362 0.03
363 0.03
364 0.03
365 0.03
366 0.03
367 0.04
368 0.04
369 0.04
370 0.04
371 0.05
372 0.05
373 0.06
374 0.05
375 0.05
376 0.05
377 0.05
378 0.05
379 0.05
380 0.06
381 0.06
382 0.06
383 0.07
384 0.07
385 0.08
386 0.08
387 0.08
388 0.08
389 0.08
390 0.09
391 0.1
392 0.1
393 0.1
394 0.1
395 0.11
396 0.09
397 0.1
398 0.09
399 0.08
400 0.09
401 0.09
402 0.09
403 0.12
404 0.12
405 0.12
406 0.12
407 0.12
408 0.11
409 0.11
410 0.11
411 0.08
412 0.07
413 0.07
414 0.07
415 0.07
416 0.06
417 0.05
418 0.06
419 0.05
420 0.08
421 0.08
422 0.08
423 0.09
424 0.09
425 0.1
426 0.11
427 0.12
428 0.1
429 0.09
430 0.09
431 0.08
432 0.08
433 0.07
434 0.05
435 0.05
436 0.04
437 0.03
438 0.03
439 0.03
440 0.03
441 0.03
442 0.03
443 0.04
444 0.03
445 0.04
446 0.04
447 0.04
448 0.04
449 0.03
450 0.03
451 0.03
452 0.04
453 0.04
454 0.04
455 0.06
456 0.09
457 0.11
458 0.12
459 0.13
460 0.18
461 0.25
462 0.26
463 0.31
464 0.31
465 0.34
466 0.37
467 0.39
468 0.37
469 0.34
470 0.34
471 0.3
472 0.36
473 0.38
474 0.44
475 0.45
476 0.52
477 0.51
478 0.56
479 0.58
480 0.53
481 0.55
482 0.57
483 0.63
484 0.66
485 0.73
486 0.77
487 0.83
488 0.88
489 0.86
490 0.85
491 0.85
492 0.83
493 0.81
494 0.78
495 0.7
496 0.61
497 0.56
498 0.46
499 0.35
500 0.27
501 0.19
502 0.13
503 0.1
504 0.12
505 0.1
506 0.1
507 0.11
508 0.11
509 0.11
510 0.11
511 0.12
512 0.11
513 0.13
514 0.13
515 0.13
516 0.13
517 0.16
518 0.2
519 0.27
520 0.32
521 0.33
522 0.35
523 0.34
524 0.36
525 0.34
526 0.29