Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WTJ1

Protein Details
Accession A0A0B2WTJ1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
374-393PTQPGKKKTKAPKTKSTSSYHydrophilic
NLS Segment(s)
PositionSequence
379-384KKKTKA
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR011004  Trimer_LpxA-like_sf  
Gene Ontology GO:0004475  F:mannose-1-phosphate guanylyltransferase (GTP) activity  
Amino Acid Sequences MRTAAILAIAGFLKSHAQAQPSVAEHEPSVDVDIQGLNETDVGPQGPRGLLPDVCYCARCGYNMNVCTCKDPLLPSCMVKAKLHTSTVTWKPATYTFTTPRAYVYCRANSSWANLEANSQSATNPHVGADSHVGANSHVGADSHAGANSYLEANSHLGTNSYLGTNLYPGAKLHVGADSHAGANSHAGANSHAGANSYLEANSHLGTNSYLGTNSHVGAYPHMGTDLYRRANSHLEANSYLEANSYLEANSYLEANSYLRANSHLEANSYLEANSYLEANSHLEANSHVGANAHLGTDSHVGANSHLGTNQALRDYLYHRTNLYQEADSHLEADSHLEANSYQGAKSHLDDYRALRAHSYRQTNSVPAEQYLGPTQPGKKKTKAPKTKSTSSYAAVPTYSPGPTHTGEKPTYSKPAYTTSLKKVLLPSPGANIQRRSDDYHEAAGCGAEDVKPCDKTHPHCPHCGKPYDEAHPPNDGTPCDGHDHEGHACPQGCHHPAPAQNGTQWLAPSASMMGGGDRMPVSTDTPISAGEVTSVSGTALGIVFVAGFLLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.15
3 0.16
4 0.18
5 0.2
6 0.22
7 0.27
8 0.27
9 0.31
10 0.27
11 0.26
12 0.23
13 0.24
14 0.23
15 0.18
16 0.19
17 0.16
18 0.14
19 0.14
20 0.15
21 0.13
22 0.13
23 0.12
24 0.09
25 0.09
26 0.09
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.11
33 0.11
34 0.11
35 0.14
36 0.16
37 0.17
38 0.2
39 0.23
40 0.25
41 0.27
42 0.27
43 0.25
44 0.25
45 0.25
46 0.23
47 0.23
48 0.26
49 0.34
50 0.38
51 0.41
52 0.42
53 0.42
54 0.44
55 0.4
56 0.36
57 0.29
58 0.29
59 0.28
60 0.3
61 0.32
62 0.3
63 0.35
64 0.37
65 0.38
66 0.35
67 0.36
68 0.37
69 0.38
70 0.39
71 0.35
72 0.32
73 0.38
74 0.43
75 0.45
76 0.39
77 0.35
78 0.35
79 0.37
80 0.38
81 0.34
82 0.35
83 0.33
84 0.39
85 0.41
86 0.38
87 0.37
88 0.36
89 0.36
90 0.35
91 0.36
92 0.36
93 0.38
94 0.39
95 0.4
96 0.38
97 0.38
98 0.37
99 0.33
100 0.28
101 0.25
102 0.27
103 0.23
104 0.23
105 0.2
106 0.15
107 0.12
108 0.11
109 0.13
110 0.12
111 0.12
112 0.11
113 0.11
114 0.11
115 0.13
116 0.15
117 0.14
118 0.13
119 0.13
120 0.13
121 0.12
122 0.13
123 0.11
124 0.08
125 0.07
126 0.06
127 0.06
128 0.08
129 0.09
130 0.09
131 0.08
132 0.09
133 0.08
134 0.08
135 0.09
136 0.08
137 0.07
138 0.06
139 0.08
140 0.08
141 0.09
142 0.09
143 0.08
144 0.08
145 0.08
146 0.09
147 0.08
148 0.07
149 0.08
150 0.07
151 0.08
152 0.08
153 0.09
154 0.08
155 0.08
156 0.08
157 0.11
158 0.11
159 0.11
160 0.11
161 0.13
162 0.12
163 0.12
164 0.14
165 0.12
166 0.12
167 0.12
168 0.11
169 0.08
170 0.09
171 0.09
172 0.08
173 0.07
174 0.07
175 0.07
176 0.08
177 0.09
178 0.09
179 0.08
180 0.08
181 0.08
182 0.09
183 0.08
184 0.08
185 0.07
186 0.07
187 0.08
188 0.09
189 0.09
190 0.09
191 0.08
192 0.08
193 0.08
194 0.09
195 0.08
196 0.07
197 0.08
198 0.07
199 0.1
200 0.1
201 0.1
202 0.1
203 0.1
204 0.1
205 0.11
206 0.12
207 0.1
208 0.09
209 0.09
210 0.09
211 0.08
212 0.11
213 0.16
214 0.17
215 0.17
216 0.18
217 0.2
218 0.23
219 0.24
220 0.25
221 0.21
222 0.21
223 0.21
224 0.21
225 0.19
226 0.17
227 0.16
228 0.1
229 0.09
230 0.07
231 0.07
232 0.06
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.06
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.08
248 0.09
249 0.09
250 0.12
251 0.12
252 0.12
253 0.13
254 0.14
255 0.13
256 0.11
257 0.11
258 0.08
259 0.08
260 0.07
261 0.07
262 0.06
263 0.05
264 0.05
265 0.06
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.07
272 0.08
273 0.08
274 0.07
275 0.07
276 0.07
277 0.07
278 0.08
279 0.07
280 0.05
281 0.05
282 0.05
283 0.06
284 0.07
285 0.08
286 0.07
287 0.07
288 0.07
289 0.07
290 0.09
291 0.08
292 0.07
293 0.07
294 0.08
295 0.07
296 0.08
297 0.09
298 0.08
299 0.08
300 0.08
301 0.09
302 0.11
303 0.17
304 0.17
305 0.18
306 0.18
307 0.19
308 0.21
309 0.22
310 0.22
311 0.18
312 0.16
313 0.19
314 0.2
315 0.18
316 0.18
317 0.14
318 0.12
319 0.1
320 0.11
321 0.08
322 0.07
323 0.07
324 0.07
325 0.06
326 0.07
327 0.1
328 0.09
329 0.08
330 0.09
331 0.11
332 0.12
333 0.13
334 0.17
335 0.16
336 0.18
337 0.21
338 0.22
339 0.28
340 0.29
341 0.28
342 0.25
343 0.25
344 0.3
345 0.34
346 0.38
347 0.31
348 0.35
349 0.37
350 0.38
351 0.38
352 0.36
353 0.3
354 0.23
355 0.25
356 0.2
357 0.2
358 0.18
359 0.17
360 0.14
361 0.15
362 0.2
363 0.24
364 0.32
365 0.37
366 0.41
367 0.5
368 0.59
369 0.68
370 0.73
371 0.75
372 0.77
373 0.8
374 0.83
375 0.79
376 0.74
377 0.67
378 0.58
379 0.55
380 0.46
381 0.39
382 0.3
383 0.25
384 0.21
385 0.19
386 0.17
387 0.12
388 0.12
389 0.15
390 0.16
391 0.2
392 0.22
393 0.26
394 0.27
395 0.31
396 0.34
397 0.33
398 0.39
399 0.36
400 0.34
401 0.31
402 0.35
403 0.36
404 0.38
405 0.41
406 0.4
407 0.47
408 0.45
409 0.45
410 0.44
411 0.43
412 0.42
413 0.39
414 0.34
415 0.3
416 0.36
417 0.39
418 0.39
419 0.39
420 0.36
421 0.38
422 0.39
423 0.4
424 0.39
425 0.4
426 0.38
427 0.4
428 0.38
429 0.33
430 0.3
431 0.25
432 0.2
433 0.14
434 0.12
435 0.08
436 0.09
437 0.13
438 0.18
439 0.2
440 0.21
441 0.28
442 0.34
443 0.38
444 0.48
445 0.55
446 0.55
447 0.62
448 0.68
449 0.7
450 0.71
451 0.73
452 0.65
453 0.61
454 0.63
455 0.6
456 0.61
457 0.57
458 0.51
459 0.49
460 0.47
461 0.42
462 0.39
463 0.33
464 0.28
465 0.25
466 0.25
467 0.24
468 0.24
469 0.24
470 0.22
471 0.26
472 0.26
473 0.27
474 0.26
475 0.28
476 0.29
477 0.26
478 0.29
479 0.33
480 0.33
481 0.32
482 0.34
483 0.34
484 0.37
485 0.44
486 0.46
487 0.4
488 0.38
489 0.4
490 0.39
491 0.34
492 0.3
493 0.23
494 0.19
495 0.16
496 0.15
497 0.12
498 0.11
499 0.09
500 0.09
501 0.08
502 0.08
503 0.08
504 0.09
505 0.09
506 0.09
507 0.11
508 0.12
509 0.14
510 0.15
511 0.16
512 0.15
513 0.16
514 0.16
515 0.16
516 0.15
517 0.12
518 0.11
519 0.1
520 0.1
521 0.09
522 0.09
523 0.07
524 0.07
525 0.07
526 0.07
527 0.06
528 0.06
529 0.05
530 0.05
531 0.05
532 0.04