FuNGI

A0A0B2WTJ1

Protein Details

Accession

A0A0B2WTJ1

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
374-393	PTQPGKKKTKAPKTKSTSSY	Hydrophilic

NLS Segment(s)

Position	Sequence
379-384	KKKTKA

Subcellular Location(s)

extr 25

Family & Domain DBs

InterPro	View protein in InterPro IPR011004 Trimer_LpxA-like_sf
Gene Ontology	GO:0004475 F:mannose-1-phosphate guanylyltransferase (GTP) activity

Amino Acid Sequences

MRTAAILAIAGFLKSHAQAQPSVAEHEPSVDVDIQGLNETDVGPQGPRGLLPDVCYCARCGYNMNVCTCKDPLLPSCMVKAKLHTSTVTWKPATYTFTTPRAYVYCRANSSWANLEANSQSATNPHVGADSHVGANSHVGADSHAGANSYLEANSHLGTNSYLGTNLYPGAKLHVGADSHAGANSHAGANSHAGANSYLEANSHLGTNSYLGTNSHVGAYPHMGTDLYRRANSHLEANSYLEANSYLEANSYLEANSYLRANSHLEANSYLEANSYLEANSHLEANSHVGANAHLGTDSHVGANSHLGTNQALRDYLYHRTNLYQEADSHLEADSHLEANSYQGAKSHLDDYRALRAHSYRQTNSVPAEQYLGPTQPGKKKTKAPKTKSTSSYAAVPTYSPGPTHTGEKPTYSKPAYTTSLKKVLLPSPGANIQRRSDDYHEAAGCGAEDVKPCDKTHPHCPHCGKPYDEAHPPNDGTPCDGHDHEGHACPQGCHHPAPAQNGTQWLAPSASMMGGGDRMPVSTDTPISAGEVTSVSGTALGIVFVAGFLLF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.1
2	0.15
3	0.16
4	0.18
5	0.2
6	0.22
7	0.27
8	0.27
9	0.31
10	0.27
11	0.26
12	0.23
13	0.24
14	0.23
15	0.18
16	0.19
17	0.16
18	0.14
19	0.14
20	0.15
21	0.13
22	0.13
23	0.12
24	0.09
25	0.09
26	0.09
27	0.08
28	0.09
29	0.09
30	0.09
31	0.09
32	0.11
33	0.11
34	0.11
35	0.14
36	0.16
37	0.17
38	0.2
39	0.23
40	0.25
41	0.27
42	0.27
43	0.25
44	0.25
45	0.25
46	0.23
47	0.23
48	0.26
49	0.34
50	0.38
51	0.41
52	0.42
53	0.42
54	0.44
55	0.4
56	0.36
57	0.29
58	0.29
59	0.28
60	0.3
61	0.32
62	0.3
63	0.35
64	0.37
65	0.38
66	0.35
67	0.36
68	0.37
69	0.38
70	0.39
71	0.35
72	0.32
73	0.38
74	0.43
75	0.45
76	0.39
77	0.35
78	0.35
79	0.37
80	0.38
81	0.34
82	0.35
83	0.33
84	0.39
85	0.41
86	0.38
87	0.37
88	0.36
89	0.36
90	0.35
91	0.36
92	0.36
93	0.38
94	0.39
95	0.4
96	0.38
97	0.38
98	0.37
99	0.33
100	0.28
101	0.25
102	0.27
103	0.23
104	0.23
105	0.2
106	0.15
107	0.12
108	0.11
109	0.13
110	0.12
111	0.12
112	0.11
113	0.11
114	0.11
115	0.13
116	0.15
117	0.14
118	0.13
119	0.13
120	0.13
121	0.12
122	0.13
123	0.11
124	0.08
125	0.07
126	0.06
127	0.06
128	0.08
129	0.09
130	0.09
131	0.08
132	0.09
133	0.08
134	0.08
135	0.09
136	0.08
137	0.07
138	0.06
139	0.08
140	0.08
141	0.09
142	0.09
143	0.08
144	0.08
145	0.08
146	0.09
147	0.08
148	0.07
149	0.08
150	0.07
151	0.08
152	0.08
153	0.09
154	0.08
155	0.08
156	0.08
157	0.11
158	0.11
159	0.11
160	0.11
161	0.13
162	0.12
163	0.12
164	0.14
165	0.12
166	0.12
167	0.12
168	0.11
169	0.08
170	0.09
171	0.09
172	0.08
173	0.07
174	0.07
175	0.07
176	0.08
177	0.09
178	0.09
179	0.08
180	0.08
181	0.08
182	0.09
183	0.08
184	0.08
185	0.07
186	0.07
187	0.08
188	0.09
189	0.09
190	0.09
191	0.08
192	0.08
193	0.08
194	0.09
195	0.08
196	0.07
197	0.08
198	0.07
199	0.1
200	0.1
201	0.1
202	0.1
203	0.1
204	0.1
205	0.11
206	0.12
207	0.1
208	0.09
209	0.09
210	0.09
211	0.08
212	0.11
213	0.16
214	0.17
215	0.17
216	0.18
217	0.2
218	0.23
219	0.24
220	0.25
221	0.21
222	0.21
223	0.21
224	0.21
225	0.19
226	0.17
227	0.16
228	0.1
229	0.09
230	0.07
231	0.07
232	0.06
233	0.05
234	0.05
235	0.05
236	0.05
237	0.05
238	0.05
239	0.05
240	0.05
241	0.06
242	0.06
243	0.06
244	0.06
245	0.06
246	0.06
247	0.08
248	0.09
249	0.09
250	0.12
251	0.12
252	0.12
253	0.13
254	0.14
255	0.13
256	0.11
257	0.11
258	0.08
259	0.08
260	0.07
261	0.07
262	0.06
263	0.05
264	0.05
265	0.06
266	0.06
267	0.06
268	0.06
269	0.06
270	0.06
271	0.07
272	0.08
273	0.08
274	0.07
275	0.07
276	0.07
277	0.07
278	0.08
279	0.07
280	0.05
281	0.05
282	0.05
283	0.06
284	0.07
285	0.08
286	0.07
287	0.07
288	0.07
289	0.07
290	0.09
291	0.08
292	0.07
293	0.07
294	0.08
295	0.07
296	0.08
297	0.09
298	0.08
299	0.08
300	0.08
301	0.09
302	0.11
303	0.17
304	0.17
305	0.18
306	0.18
307	0.19
308	0.21
309	0.22
310	0.22
311	0.18
312	0.16
313	0.19
314	0.2
315	0.18
316	0.18
317	0.14
318	0.12
319	0.1
320	0.11
321	0.08
322	0.07
323	0.07
324	0.07
325	0.06
326	0.07
327	0.1
328	0.09
329	0.08
330	0.09
331	0.11
332	0.12
333	0.13
334	0.17
335	0.16
336	0.18
337	0.21
338	0.22
339	0.28
340	0.29
341	0.28
342	0.25
343	0.25
344	0.3
345	0.34
346	0.38
347	0.31
348	0.35
349	0.37
350	0.38
351	0.38
352	0.36
353	0.3
354	0.23
355	0.25
356	0.2
357	0.2
358	0.18
359	0.17
360	0.14
361	0.15
362	0.2
363	0.24
364	0.32
365	0.37
366	0.41
367	0.5
368	0.59
369	0.68
370	0.73
371	0.75
372	0.77
373	0.8
374	0.83
375	0.79
376	0.74
377	0.67
378	0.58
379	0.55
380	0.46
381	0.39
382	0.3
383	0.25
384	0.21
385	0.19
386	0.17
387	0.12
388	0.12
389	0.15
390	0.16
391	0.2
392	0.22
393	0.26
394	0.27
395	0.31
396	0.34
397	0.33
398	0.39
399	0.36
400	0.34
401	0.31
402	0.35
403	0.36
404	0.38
405	0.41
406	0.4
407	0.47
408	0.45
409	0.45
410	0.44
411	0.43
412	0.42
413	0.39
414	0.34
415	0.3
416	0.36
417	0.39
418	0.39
419	0.39
420	0.36
421	0.38
422	0.39
423	0.4
424	0.39
425	0.4
426	0.38
427	0.4
428	0.38
429	0.33
430	0.3
431	0.25
432	0.2
433	0.14
434	0.12
435	0.08
436	0.09
437	0.13
438	0.18
439	0.2
440	0.21
441	0.28
442	0.34
443	0.38
444	0.48
445	0.55
446	0.55
447	0.62
448	0.68
449	0.7
450	0.71
451	0.73
452	0.65
453	0.61
454	0.63
455	0.6
456	0.61
457	0.57
458	0.51
459	0.49
460	0.47
461	0.42
462	0.39
463	0.33
464	0.28
465	0.25
466	0.25
467	0.24
468	0.24
469	0.24
470	0.22
471	0.26
472	0.26
473	0.27
474	0.26
475	0.28
476	0.29
477	0.26
478	0.29
479	0.33
480	0.33
481	0.32
482	0.34
483	0.34
484	0.37
485	0.44
486	0.46
487	0.4
488	0.38
489	0.4
490	0.39
491	0.34
492	0.3
493	0.23
494	0.19
495	0.16
496	0.15
497	0.12
498	0.11
499	0.09
500	0.09
501	0.08
502	0.08
503	0.08
504	0.09
505	0.09
506	0.09
507	0.11
508	0.12
509	0.14
510	0.15
511	0.16
512	0.15
513	0.16
514	0.16
515	0.16
516	0.15
517	0.12
518	0.11
519	0.1
520	0.1
521	0.09
522	0.09
523	0.07
524	0.07
525	0.07
526	0.07
527	0.06
528	0.06
529	0.05
530	0.05
531	0.05
532	0.04

A0A0B2WTJ1

3D AlphaFold-predicted Structure Viewer