Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0B2WQA7

Protein Details
Accession A0A0B2WQA7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MDYYIKRTVERVRQRRRSRADIEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MDYYIKRTVERVRQRRRSRADIEEEMSIDESKSARLSVCPPAAGAPERACRVQNDAEASSSVDLHLAARNSIANMDIAHDDSVECKDGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.88
4 0.86
5 0.82
6 0.79
7 0.76
8 0.71
9 0.63
10 0.54
11 0.46
12 0.38
13 0.32
14 0.24
15 0.15
16 0.11
17 0.09
18 0.08
19 0.08
20 0.08
21 0.07
22 0.08
23 0.11
24 0.16
25 0.17
26 0.16
27 0.16
28 0.16
29 0.17
30 0.17
31 0.16
32 0.12
33 0.14
34 0.16
35 0.17
36 0.17
37 0.16
38 0.19
39 0.2
40 0.2
41 0.21
42 0.2
43 0.2
44 0.2
45 0.19
46 0.15
47 0.13
48 0.1
49 0.07
50 0.06
51 0.06
52 0.09
53 0.08
54 0.08
55 0.09
56 0.1
57 0.1
58 0.1
59 0.1
60 0.08
61 0.07
62 0.09
63 0.1
64 0.11
65 0.11
66 0.1
67 0.1
68 0.11
69 0.13
70 0.13