Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AP98

Protein Details
Accession A0A075AP98   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
112-133NKFSKFKSFKWIKLKYKINLLFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 7, E.R. 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005336  MPC  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0006850  P:mitochondrial pyruvate transmembrane transport  
Pfam View protein in Pfam  
PF03650  MPC  
Amino Acid Sequences MASFQKLWNHPAGPKTIHFWAPAMKWALVVAGLGDLSRPAEKLSVSQNTALLATGLIWSRYSTQIIPVNYSLLLVNLFVGLTGATQLYRIAQKKISDDSEIVIGEMGDSQANKFSKFKSFKWIKLKYKINLLFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.36
4 0.35
5 0.33
6 0.3
7 0.3
8 0.27
9 0.31
10 0.29
11 0.25
12 0.23
13 0.21
14 0.2
15 0.15
16 0.13
17 0.08
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.05
24 0.05
25 0.06
26 0.06
27 0.07
28 0.07
29 0.1
30 0.15
31 0.19
32 0.2
33 0.2
34 0.2
35 0.19
36 0.19
37 0.17
38 0.11
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.08
47 0.09
48 0.1
49 0.09
50 0.13
51 0.17
52 0.17
53 0.19
54 0.17
55 0.17
56 0.15
57 0.16
58 0.11
59 0.07
60 0.07
61 0.05
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.11
76 0.13
77 0.15
78 0.19
79 0.22
80 0.25
81 0.29
82 0.3
83 0.27
84 0.26
85 0.24
86 0.23
87 0.21
88 0.17
89 0.13
90 0.1
91 0.07
92 0.07
93 0.07
94 0.05
95 0.05
96 0.06
97 0.12
98 0.13
99 0.15
100 0.17
101 0.19
102 0.29
103 0.35
104 0.36
105 0.41
106 0.49
107 0.56
108 0.64
109 0.72
110 0.72
111 0.76
112 0.84
113 0.78
114 0.81