Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P0CO76

Protein Details
Accession P0CO76    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-65NDEKGKTKGKEKKSDDRDMSBasic
NLS Segment(s)
Subcellular Location(s) cysk 9, cyto 7.5, cyto_nucl 6.5, nucl 4.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037212  Med7/Med21-like  
IPR009244  Mediatior_Med7  
IPR044888  Mediatior_Med7_sf  
Gene Ontology GO:0070847  C:core mediator complex  
GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG cne:CNM01330  -  
Pfam View protein in Pfam  
PF05983  Med7  
Amino Acid Sequences MSSLPQEAALPITNTLFPPPPPYFQAFTDEAIERYETLTGKSLFVNDEKGKTKGKEKKSDDRDMSVDIRIQDLTEEEQNEKLELEGKLEKPRADWVNEDGRWMCFGTMYTTEPIIPTAQSIGLPPFIDPAVEPQESLPPLLHSFLHTLLLLLDTLTMTARTPNELAAAGWASEGDQYIQHLTNLSANMMVASNQLRSAQSEATLVLLMEKELEERRKQTEKLRSKCKEIASGIRALKGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.18
4 0.16
5 0.23
6 0.25
7 0.27
8 0.31
9 0.35
10 0.35
11 0.34
12 0.39
13 0.34
14 0.32
15 0.33
16 0.29
17 0.25
18 0.23
19 0.22
20 0.17
21 0.15
22 0.16
23 0.12
24 0.13
25 0.18
26 0.17
27 0.18
28 0.18
29 0.19
30 0.18
31 0.19
32 0.25
33 0.22
34 0.26
35 0.28
36 0.31
37 0.36
38 0.36
39 0.45
40 0.47
41 0.54
42 0.59
43 0.64
44 0.72
45 0.74
46 0.81
47 0.75
48 0.7
49 0.63
50 0.56
51 0.5
52 0.41
53 0.35
54 0.25
55 0.22
56 0.18
57 0.15
58 0.11
59 0.11
60 0.12
61 0.12
62 0.13
63 0.13
64 0.14
65 0.15
66 0.15
67 0.14
68 0.11
69 0.13
70 0.11
71 0.14
72 0.16
73 0.18
74 0.23
75 0.26
76 0.26
77 0.23
78 0.29
79 0.29
80 0.26
81 0.26
82 0.24
83 0.31
84 0.31
85 0.31
86 0.26
87 0.23
88 0.22
89 0.21
90 0.16
91 0.08
92 0.08
93 0.09
94 0.1
95 0.11
96 0.1
97 0.1
98 0.11
99 0.1
100 0.11
101 0.09
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.06
110 0.07
111 0.06
112 0.07
113 0.06
114 0.06
115 0.06
116 0.08
117 0.12
118 0.12
119 0.12
120 0.11
121 0.15
122 0.15
123 0.15
124 0.12
125 0.09
126 0.1
127 0.11
128 0.1
129 0.09
130 0.1
131 0.1
132 0.11
133 0.1
134 0.09
135 0.08
136 0.08
137 0.07
138 0.05
139 0.05
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.06
146 0.07
147 0.09
148 0.09
149 0.09
150 0.1
151 0.1
152 0.1
153 0.09
154 0.09
155 0.07
156 0.07
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.06
164 0.09
165 0.09
166 0.09
167 0.1
168 0.1
169 0.13
170 0.13
171 0.12
172 0.1
173 0.09
174 0.1
175 0.09
176 0.09
177 0.08
178 0.08
179 0.09
180 0.09
181 0.11
182 0.11
183 0.13
184 0.15
185 0.14
186 0.14
187 0.14
188 0.13
189 0.13
190 0.13
191 0.1
192 0.09
193 0.08
194 0.07
195 0.07
196 0.07
197 0.09
198 0.14
199 0.2
200 0.24
201 0.27
202 0.35
203 0.41
204 0.45
205 0.52
206 0.58
207 0.63
208 0.68
209 0.76
210 0.75
211 0.76
212 0.78
213 0.74
214 0.72
215 0.67
216 0.67
217 0.6
218 0.62
219 0.56