Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075ARN8

Protein Details
Accession A0A075ARN8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
259-278EENPKLTKRLRYIRNVFRVPHydrophilic
NLS Segment(s)
PositionSequence
45-103KAKVEKAKPQEEKAKVEKAKREKEKEELEAKVKAQEEKAKVEKAKRVKLETKVKAQEKG
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MKTNGVSKRKGKDEHSVQTTKKPKSDKLQARLVELEAQLKAQEEKAKVEKAKPQEEKAKVEKAKREKEKEELEAKVKAQEEKAKVEKAKRVKLETKVKAQEKGNKLRDEPEFKNVEDLINDINTTDINDDLAFVVLAASSGTGKTQTAFTLLANNRKVKYVTCCSVGETSQNIYEAFSSISEGFAKSIDRDLTVYKRYGLDNFWELKNNDDFKLMSYGFIKAYILETPKVEAITREEVLVCLESRDVIFFLDEFPCNDEENPKLTKRLRYIRNVFRXVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.73
4 0.66
5 0.7
6 0.74
7 0.69
8 0.65
9 0.62
10 0.62
11 0.64
12 0.73
13 0.73
14 0.71
15 0.75
16 0.71
17 0.68
18 0.63
19 0.54
20 0.47
21 0.38
22 0.33
23 0.24
24 0.22
25 0.18
26 0.17
27 0.17
28 0.15
29 0.2
30 0.19
31 0.25
32 0.3
33 0.37
34 0.38
35 0.43
36 0.46
37 0.49
38 0.58
39 0.57
40 0.59
41 0.62
42 0.64
43 0.66
44 0.65
45 0.67
46 0.62
47 0.63
48 0.65
49 0.66
50 0.7
51 0.73
52 0.75
53 0.7
54 0.72
55 0.72
56 0.7
57 0.66
58 0.6
59 0.54
60 0.49
61 0.45
62 0.41
63 0.36
64 0.31
65 0.29
66 0.32
67 0.31
68 0.35
69 0.39
70 0.41
71 0.43
72 0.47
73 0.5
74 0.52
75 0.56
76 0.55
77 0.58
78 0.57
79 0.63
80 0.68
81 0.67
82 0.67
83 0.68
84 0.66
85 0.64
86 0.63
87 0.62
88 0.6
89 0.64
90 0.62
91 0.56
92 0.54
93 0.54
94 0.54
95 0.53
96 0.47
97 0.44
98 0.39
99 0.36
100 0.38
101 0.32
102 0.27
103 0.19
104 0.18
105 0.12
106 0.09
107 0.09
108 0.06
109 0.06
110 0.05
111 0.06
112 0.05
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.02
125 0.02
126 0.02
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.05
133 0.05
134 0.07
135 0.07
136 0.07
137 0.15
138 0.17
139 0.23
140 0.26
141 0.29
142 0.28
143 0.29
144 0.3
145 0.24
146 0.29
147 0.28
148 0.27
149 0.28
150 0.28
151 0.28
152 0.29
153 0.28
154 0.23
155 0.18
156 0.17
157 0.14
158 0.14
159 0.12
160 0.11
161 0.1
162 0.09
163 0.08
164 0.07
165 0.08
166 0.07
167 0.08
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.07
174 0.1
175 0.1
176 0.1
177 0.11
178 0.14
179 0.18
180 0.21
181 0.21
182 0.2
183 0.21
184 0.22
185 0.23
186 0.21
187 0.21
188 0.23
189 0.25
190 0.24
191 0.28
192 0.27
193 0.29
194 0.34
195 0.32
196 0.28
197 0.27
198 0.26
199 0.22
200 0.28
201 0.24
202 0.19
203 0.18
204 0.19
205 0.17
206 0.17
207 0.15
208 0.1
209 0.11
210 0.13
211 0.15
212 0.15
213 0.15
214 0.16
215 0.17
216 0.18
217 0.17
218 0.15
219 0.17
220 0.21
221 0.21
222 0.2
223 0.19
224 0.18
225 0.2
226 0.19
227 0.15
228 0.1
229 0.1
230 0.1
231 0.1
232 0.11
233 0.09
234 0.08
235 0.09
236 0.08
237 0.1
238 0.13
239 0.13
240 0.13
241 0.16
242 0.17
243 0.18
244 0.19
245 0.2
246 0.2
247 0.24
248 0.28
249 0.28
250 0.34
251 0.38
252 0.45
253 0.51
254 0.59
255 0.63
256 0.69
257 0.77
258 0.79