Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075ARJ3

Protein Details
Accession A0A075ARJ3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
255-276EAYRRLQKSKDVSAPRKCLKRVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0000124  C:SAGA complex  
GO:0046695  C:SLIK (SAGA-like) complex  
GO:0046982  F:protein heterodimerization activity  
GO:0003712  F:transcription coregulator activity  
GO:0003743  F:translation initiation factor activity  
GO:0006325  P:chromatin organization  
GO:0016573  P:histone acetylation  
GO:0001403  P:invasive growth in response to glucose limitation  
GO:0007124  P:pseudohyphal growth  
GO:0006357  P:regulation of transcription by RNA polymerase II  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MMYTFGDVRRCLPEVSKLVEDIVRDQIINLVIMSKTNSKAIQAAALAQKRSSRFISSDDLMFLVRSDKSKLSRIKEYIFWKEVRKNMKGTDEVGLAEGAAPEKKNKRKHITVGWNFLESFQEFVQDESDFPKGASLDESFKKRLEENDKVTRNMSREEYMDYADCRSASFYAKKSKRFKEWINLGAYIDVKASEEVFELLGYLCWESVKTITENALIVKWDELMAERKNQLNNVDIGLFAAPLEQRPIQPSHIMEAYRRLQKSKDVSAPRKCLKRVRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.37
4 0.33
5 0.33
6 0.33
7 0.31
8 0.25
9 0.26
10 0.21
11 0.19
12 0.19
13 0.19
14 0.18
15 0.18
16 0.15
17 0.11
18 0.1
19 0.11
20 0.14
21 0.15
22 0.16
23 0.19
24 0.2
25 0.19
26 0.21
27 0.21
28 0.21
29 0.18
30 0.21
31 0.25
32 0.28
33 0.28
34 0.27
35 0.31
36 0.3
37 0.33
38 0.31
39 0.28
40 0.25
41 0.29
42 0.33
43 0.31
44 0.3
45 0.27
46 0.24
47 0.21
48 0.19
49 0.15
50 0.11
51 0.11
52 0.11
53 0.14
54 0.17
55 0.21
56 0.29
57 0.36
58 0.39
59 0.47
60 0.49
61 0.5
62 0.53
63 0.56
64 0.55
65 0.52
66 0.49
67 0.47
68 0.48
69 0.5
70 0.5
71 0.47
72 0.44
73 0.43
74 0.46
75 0.42
76 0.38
77 0.34
78 0.28
79 0.25
80 0.22
81 0.17
82 0.12
83 0.1
84 0.08
85 0.06
86 0.06
87 0.06
88 0.11
89 0.19
90 0.27
91 0.36
92 0.45
93 0.52
94 0.58
95 0.65
96 0.7
97 0.73
98 0.72
99 0.72
100 0.64
101 0.57
102 0.5
103 0.43
104 0.34
105 0.23
106 0.18
107 0.1
108 0.11
109 0.09
110 0.1
111 0.11
112 0.09
113 0.09
114 0.09
115 0.1
116 0.08
117 0.08
118 0.09
119 0.08
120 0.08
121 0.09
122 0.08
123 0.12
124 0.15
125 0.18
126 0.18
127 0.19
128 0.2
129 0.19
130 0.25
131 0.29
132 0.33
133 0.37
134 0.45
135 0.47
136 0.47
137 0.47
138 0.43
139 0.37
140 0.33
141 0.28
142 0.2
143 0.18
144 0.2
145 0.19
146 0.18
147 0.17
148 0.15
149 0.13
150 0.12
151 0.11
152 0.09
153 0.09
154 0.09
155 0.12
156 0.16
157 0.19
158 0.29
159 0.34
160 0.43
161 0.51
162 0.57
163 0.61
164 0.65
165 0.67
166 0.66
167 0.69
168 0.66
169 0.61
170 0.55
171 0.47
172 0.41
173 0.35
174 0.25
175 0.17
176 0.11
177 0.08
178 0.07
179 0.07
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.05
190 0.05
191 0.05
192 0.05
193 0.06
194 0.07
195 0.09
196 0.1
197 0.11
198 0.12
199 0.13
200 0.14
201 0.14
202 0.13
203 0.12
204 0.11
205 0.1
206 0.09
207 0.08
208 0.08
209 0.09
210 0.14
211 0.15
212 0.2
213 0.22
214 0.26
215 0.28
216 0.31
217 0.31
218 0.29
219 0.28
220 0.25
221 0.22
222 0.18
223 0.17
224 0.14
225 0.12
226 0.08
227 0.08
228 0.07
229 0.07
230 0.12
231 0.12
232 0.14
233 0.18
234 0.21
235 0.22
236 0.26
237 0.27
238 0.28
239 0.3
240 0.3
241 0.28
242 0.33
243 0.37
244 0.41
245 0.42
246 0.4
247 0.38
248 0.46
249 0.52
250 0.53
251 0.56
252 0.58
253 0.66
254 0.73
255 0.81
256 0.81
257 0.82
258 0.79
259 0.79