Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075AVN9

Protein Details
Accession A0A075AVN9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-89DENGAPKRKRGRPSKVGAALSHydrophilic
NLS Segment(s)
PositionSequence
74-83PKRKRGRPSK
Subcellular Location(s) E.R. 9, nucl 4, mito 4, mito_nucl 4, plas 3, extr 3, cyto_nucl 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKLVTAGKVHSLIILYLVLLTIPRGIINNIPQIKDYMKELVPVTVETDIPDIRSLIPRGREKEPEIDSDENGAPKRKRGRPSKVGAALSYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.04
9 0.04
10 0.05
11 0.06
12 0.07
13 0.09
14 0.13
15 0.2
16 0.22
17 0.23
18 0.23
19 0.24
20 0.23
21 0.22
22 0.2
23 0.16
24 0.14
25 0.16
26 0.16
27 0.15
28 0.15
29 0.14
30 0.13
31 0.1
32 0.1
33 0.08
34 0.09
35 0.08
36 0.08
37 0.08
38 0.07
39 0.07
40 0.1
41 0.11
42 0.14
43 0.2
44 0.25
45 0.3
46 0.33
47 0.37
48 0.37
49 0.43
50 0.42
51 0.39
52 0.39
53 0.37
54 0.33
55 0.32
56 0.31
57 0.26
58 0.26
59 0.3
60 0.25
61 0.32
62 0.41
63 0.45
64 0.53
65 0.61
66 0.69
67 0.72
68 0.79
69 0.82
70 0.81
71 0.76