Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AS13

Protein Details
Accession A0A075AS13    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
178-198QIEEMEKSEKPKKPKKLKRLIBasic
NLS Segment(s)
PositionSequence
182-198MEKSEKPKKPKKLKRLI
Subcellular Location(s) nucl 19.5, cyto_nucl 12.333, cyto 4, cyto_mito 3.333
Family & Domain DBs
Amino Acid Sequences MKSAYTIHLTNFVEELMPYMKATVESFLRLLGDAIKKKELCIEADEKSHDDDLVMFIREEMEFFQLLWQFNFKKIQSAEGARWIRDKIIWPAISVCWHLDNHSSGDKSRDTSSKIPVSKHHDLCILNSFETDNTTSSLSDEKPEKVIVQIERNNQSPPEEEKNDELCKLKSEAVKRKQIEEMEKSEKPKKPKKLKRLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.12
4 0.11
5 0.1
6 0.1
7 0.11
8 0.11
9 0.12
10 0.13
11 0.13
12 0.14
13 0.14
14 0.14
15 0.14
16 0.13
17 0.13
18 0.15
19 0.21
20 0.23
21 0.26
22 0.32
23 0.32
24 0.32
25 0.38
26 0.34
27 0.3
28 0.3
29 0.32
30 0.28
31 0.31
32 0.32
33 0.27
34 0.27
35 0.25
36 0.19
37 0.15
38 0.13
39 0.12
40 0.12
41 0.12
42 0.1
43 0.09
44 0.1
45 0.1
46 0.1
47 0.08
48 0.08
49 0.08
50 0.08
51 0.1
52 0.12
53 0.13
54 0.13
55 0.16
56 0.15
57 0.18
58 0.23
59 0.21
60 0.24
61 0.23
62 0.26
63 0.26
64 0.28
65 0.27
66 0.31
67 0.32
68 0.27
69 0.28
70 0.26
71 0.22
72 0.2
73 0.22
74 0.17
75 0.22
76 0.22
77 0.2
78 0.21
79 0.21
80 0.21
81 0.19
82 0.16
83 0.11
84 0.1
85 0.11
86 0.11
87 0.12
88 0.13
89 0.14
90 0.14
91 0.13
92 0.16
93 0.16
94 0.16
95 0.18
96 0.18
97 0.2
98 0.22
99 0.28
100 0.32
101 0.34
102 0.34
103 0.37
104 0.44
105 0.48
106 0.46
107 0.42
108 0.4
109 0.38
110 0.38
111 0.38
112 0.31
113 0.22
114 0.21
115 0.19
116 0.15
117 0.16
118 0.15
119 0.1
120 0.09
121 0.1
122 0.1
123 0.1
124 0.13
125 0.11
126 0.14
127 0.16
128 0.16
129 0.17
130 0.18
131 0.17
132 0.17
133 0.22
134 0.22
135 0.28
136 0.32
137 0.37
138 0.41
139 0.42
140 0.42
141 0.37
142 0.35
143 0.31
144 0.32
145 0.33
146 0.33
147 0.33
148 0.37
149 0.42
150 0.42
151 0.41
152 0.37
153 0.3
154 0.3
155 0.3
156 0.3
157 0.3
158 0.38
159 0.46
160 0.52
161 0.61
162 0.6
163 0.61
164 0.63
165 0.64
166 0.63
167 0.59
168 0.58
169 0.57
170 0.59
171 0.61
172 0.63
173 0.63
174 0.65
175 0.68
176 0.71
177 0.74
178 0.81