Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075B0I9

Protein Details
Accession A0A075B0I9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
202-221EETKKDRKKVVKQKEREDVDBasic
NLS Segment(s)
PositionSequence
191-215RKAGKSTSSKSEETKKDRKKVVKQK
Subcellular Location(s) plas 7, E.R. 6, mito 4, pero 4, extr 2, golg 2, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003689  ZIP  
Gene Ontology GO:0016020  C:membrane  
GO:0046873  F:metal ion transmembrane transporter activity  
Pfam View protein in Pfam  
PF02535  Zip  
Amino Acid Sequences MMYLILFLCLFALCYGQITAELSNEITGVHKAFMMTFIGTLTSSLGFAGGVMLYVSLVELVPKSIVAFGFIDKKFAGLYACLVFLIGMLVTSLIDTFAEYIEKSDKDKQVDGNEKNEESFEKREETETSDEEENEKEEDNSDDHEGDDERGEVNELKQKADTGRTLRTRRSLRIAEKEQKPDHTLPVTGARKAGKSTSSKSEETKKDRKKVVKQKEREDVDATTGPKKDDDATKDREEWDRKEDELNKKLFRLGWKTAIALALHNIPEGMAAFVSSLADIKLGFLVTLAIVFHNIPEGLSVALPVYYATGSRWKAFLYSGVLAGMAEPLGGLIAFYFLGNHMPPLFEGMMVFVSIQGLLPTARKLDKEDKYVSKAVLIGMIVMSVGIGLINVSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.09
5 0.1
6 0.11
7 0.1
8 0.11
9 0.1
10 0.1
11 0.1
12 0.09
13 0.09
14 0.1
15 0.11
16 0.1
17 0.1
18 0.11
19 0.11
20 0.12
21 0.13
22 0.11
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.09
29 0.08
30 0.07
31 0.07
32 0.07
33 0.06
34 0.06
35 0.06
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.04
46 0.04
47 0.05
48 0.06
49 0.06
50 0.06
51 0.08
52 0.08
53 0.09
54 0.1
55 0.12
56 0.2
57 0.2
58 0.22
59 0.2
60 0.2
61 0.18
62 0.18
63 0.17
64 0.09
65 0.12
66 0.11
67 0.11
68 0.11
69 0.11
70 0.09
71 0.08
72 0.08
73 0.05
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.07
88 0.11
89 0.12
90 0.16
91 0.23
92 0.27
93 0.3
94 0.33
95 0.36
96 0.41
97 0.5
98 0.49
99 0.48
100 0.47
101 0.44
102 0.41
103 0.38
104 0.31
105 0.25
106 0.25
107 0.22
108 0.2
109 0.21
110 0.23
111 0.23
112 0.25
113 0.25
114 0.23
115 0.24
116 0.23
117 0.22
118 0.21
119 0.2
120 0.17
121 0.14
122 0.13
123 0.1
124 0.09
125 0.11
126 0.1
127 0.12
128 0.12
129 0.11
130 0.11
131 0.12
132 0.12
133 0.11
134 0.1
135 0.09
136 0.07
137 0.07
138 0.08
139 0.08
140 0.09
141 0.14
142 0.14
143 0.14
144 0.14
145 0.16
146 0.16
147 0.19
148 0.22
149 0.21
150 0.28
151 0.35
152 0.39
153 0.41
154 0.47
155 0.48
156 0.47
157 0.51
158 0.5
159 0.48
160 0.54
161 0.59
162 0.6
163 0.61
164 0.66
165 0.6
166 0.56
167 0.54
168 0.46
169 0.41
170 0.33
171 0.27
172 0.21
173 0.28
174 0.27
175 0.23
176 0.24
177 0.22
178 0.21
179 0.21
180 0.22
181 0.17
182 0.19
183 0.22
184 0.27
185 0.31
186 0.32
187 0.34
188 0.42
189 0.45
190 0.49
191 0.56
192 0.57
193 0.6
194 0.66
195 0.72
196 0.74
197 0.77
198 0.8
199 0.8
200 0.79
201 0.8
202 0.81
203 0.76
204 0.68
205 0.6
206 0.49
207 0.43
208 0.38
209 0.31
210 0.26
211 0.24
212 0.21
213 0.18
214 0.19
215 0.17
216 0.19
217 0.24
218 0.27
219 0.31
220 0.34
221 0.35
222 0.37
223 0.41
224 0.41
225 0.38
226 0.37
227 0.33
228 0.31
229 0.37
230 0.42
231 0.43
232 0.46
233 0.48
234 0.44
235 0.43
236 0.44
237 0.4
238 0.38
239 0.36
240 0.33
241 0.34
242 0.33
243 0.33
244 0.32
245 0.31
246 0.26
247 0.19
248 0.16
249 0.13
250 0.12
251 0.11
252 0.1
253 0.08
254 0.08
255 0.07
256 0.06
257 0.04
258 0.04
259 0.04
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.05
269 0.05
270 0.05
271 0.04
272 0.05
273 0.04
274 0.05
275 0.05
276 0.04
277 0.05
278 0.05
279 0.05
280 0.06
281 0.06
282 0.06
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.05
294 0.05
295 0.07
296 0.14
297 0.16
298 0.17
299 0.18
300 0.18
301 0.19
302 0.19
303 0.21
304 0.19
305 0.18
306 0.17
307 0.17
308 0.16
309 0.15
310 0.14
311 0.11
312 0.06
313 0.04
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.02
320 0.03
321 0.04
322 0.04
323 0.04
324 0.05
325 0.07
326 0.08
327 0.1
328 0.09
329 0.1
330 0.1
331 0.14
332 0.14
333 0.12
334 0.12
335 0.11
336 0.11
337 0.11
338 0.11
339 0.06
340 0.06
341 0.06
342 0.06
343 0.05
344 0.06
345 0.07
346 0.08
347 0.1
348 0.14
349 0.17
350 0.18
351 0.25
352 0.34
353 0.4
354 0.46
355 0.53
356 0.56
357 0.6
358 0.62
359 0.56
360 0.48
361 0.42
362 0.36
363 0.3
364 0.22
365 0.17
366 0.12
367 0.12
368 0.09
369 0.07
370 0.06
371 0.03
372 0.03
373 0.02
374 0.02