Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075AVC5

Protein Details
Accession A0A075AVC5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKSKNHTNHNQNRKAHRNGIHydrophilic
NLS Segment(s)
PositionSequence
14-48RKAHRNGIKKVKTHRYKSLKGVDPKFVRNQKFARR
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKKVKTHRYKSLKGVDPKFVRNQKFARRGTIRALRATKMQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.78
5 0.77
6 0.76
7 0.8
8 0.76
9 0.73
10 0.75
11 0.76
12 0.76
13 0.72
14 0.74
15 0.71
16 0.69
17 0.71
18 0.71
19 0.68
20 0.67
21 0.64
22 0.62
23 0.57
24 0.56
25 0.57
26 0.56
27 0.52
28 0.5
29 0.55
30 0.56
31 0.62
32 0.61
33 0.62
34 0.59
35 0.59
36 0.62
37 0.64
38 0.58
39 0.57
40 0.58
41 0.51