Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075B054

Protein Details
Accession A0A075B054    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSSKSPSSPSQKKKSKQGSRVSLVVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 13.166, nucl 6.5, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR029358  DUF4586  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005815  C:microtubule organizing center  
Pfam View protein in Pfam  
PF15239  DUF4586  
Amino Acid Sequences MSSKSPSSPSQKKKSKQGSRVSLVVEPSKLGLFSEVGYLQPKTFVPLHSHAFLNERTKGAQMKGSSRKLGKTKDAFFDKDFVHIFENEAYCDYSINPDLSHVNLHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.86
4 0.86
5 0.85
6 0.8
7 0.76
8 0.68
9 0.59
10 0.52
11 0.44
12 0.34
13 0.25
14 0.2
15 0.17
16 0.14
17 0.11
18 0.09
19 0.07
20 0.07
21 0.09
22 0.08
23 0.09
24 0.11
25 0.11
26 0.1
27 0.11
28 0.1
29 0.11
30 0.13
31 0.13
32 0.16
33 0.2
34 0.23
35 0.23
36 0.23
37 0.21
38 0.22
39 0.23
40 0.21
41 0.19
42 0.17
43 0.15
44 0.17
45 0.18
46 0.17
47 0.19
48 0.17
49 0.24
50 0.31
51 0.34
52 0.37
53 0.37
54 0.42
55 0.45
56 0.48
57 0.48
58 0.47
59 0.48
60 0.51
61 0.55
62 0.52
63 0.47
64 0.46
65 0.38
66 0.35
67 0.32
68 0.25
69 0.22
70 0.19
71 0.19
72 0.19
73 0.19
74 0.16
75 0.16
76 0.16
77 0.14
78 0.14
79 0.13
80 0.14
81 0.15
82 0.16
83 0.14
84 0.15
85 0.17
86 0.18