Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075AYL4

Protein Details
Accession A0A075AYL4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-47LEDSEKQKYKKLKQERNKESRAQFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MLFIEANKAPNHSLKEYIQKWNILEDSEKQKYKKLKQERNKESRAQFAEYIERCTHTINSQKASSIFNSIVSQVKLPPEEANFIEISSKDLPKPPPRSLYHYIMGRLKHDEIFAELSSETIEKYKIDYENDILNYENALKQYIERQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.42
3 0.45
4 0.51
5 0.5
6 0.48
7 0.45
8 0.46
9 0.42
10 0.34
11 0.32
12 0.29
13 0.34
14 0.38
15 0.42
16 0.38
17 0.44
18 0.51
19 0.58
20 0.62
21 0.65
22 0.68
23 0.73
24 0.84
25 0.88
26 0.89
27 0.86
28 0.83
29 0.75
30 0.73
31 0.67
32 0.59
33 0.49
34 0.42
35 0.43
36 0.36
37 0.37
38 0.29
39 0.27
40 0.24
41 0.24
42 0.23
43 0.19
44 0.26
45 0.24
46 0.27
47 0.26
48 0.27
49 0.26
50 0.27
51 0.23
52 0.19
53 0.16
54 0.14
55 0.14
56 0.14
57 0.14
58 0.13
59 0.13
60 0.11
61 0.12
62 0.11
63 0.11
64 0.11
65 0.1
66 0.12
67 0.12
68 0.13
69 0.12
70 0.11
71 0.11
72 0.1
73 0.12
74 0.12
75 0.13
76 0.12
77 0.17
78 0.23
79 0.31
80 0.37
81 0.38
82 0.44
83 0.47
84 0.54
85 0.56
86 0.56
87 0.52
88 0.49
89 0.48
90 0.44
91 0.42
92 0.36
93 0.33
94 0.3
95 0.25
96 0.23
97 0.19
98 0.18
99 0.19
100 0.17
101 0.15
102 0.13
103 0.12
104 0.12
105 0.12
106 0.1
107 0.08
108 0.09
109 0.07
110 0.1
111 0.15
112 0.18
113 0.2
114 0.23
115 0.25
116 0.3
117 0.31
118 0.3
119 0.26
120 0.23
121 0.21
122 0.2
123 0.2
124 0.14
125 0.14
126 0.14