Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AVI1

Protein Details
Accession A0A075AVI1   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-97HKKVVIKVLKPVRKRKIKREIKILQNLAHydrophilic
NLS Segment(s)
PositionSequence
75-89IKVLKPVRKRKIKRE
Subcellular Location(s) nucl 12, cyto 10.5, cyto_mito 8, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045216  CK2_alpha  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0051286  C:cell tip  
GO:0000785  C:chromatin  
GO:0032545  C:CURI complex  
GO:0000935  C:division septum  
GO:0044732  C:mitotic spindle pole body  
GO:0005956  C:protein kinase CK2 complex  
GO:0032040  C:small-subunit processome  
GO:0034456  C:UTP-C complex  
GO:0005524  F:ATP binding  
GO:0106310  F:protein serine kinase activity  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006974  P:DNA damage response  
GO:0007535  P:donor selection  
GO:0061245  P:establishment or maintenance of bipolar cell polarity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0042790  P:nucleolar large rRNA transcription by RNA polymerase I  
GO:2000247  P:positive regulation of establishment or maintenance of bipolar cell polarity regulating cell shape  
GO:0006468  P:protein phosphorylation  
GO:0051726  P:regulation of cell cycle  
GO:0060962  P:regulation of ribosomal protein gene transcription by RNA polymerase II  
GO:0006356  P:regulation of transcription by RNA polymerase I  
GO:0006359  P:regulation of transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd14132  STKc_CK2_alpha  
Amino Acid Sequences MSTGSTNTAGPVSVSKVYTYVNNEMPSEYWDYDNVSINWGSTSGFEIVRKIGRGKYSEVFEGYKTTETPHKKVVIKVLKPVRKRKIKREIKILQNLAGGPNIIQLLDVVRDSQSKTPALIFEHIQNDDFKTLYPTFTIYDIQYYLFEVLKALEFCHSKGIMHRDVKPHNIMINHATRQLRLIDWGLAEFYHAGTEYNVRVASRYFKGPELLVNFEMYDYSLDLWSLGCMLAALIFRKEPFFHGSDNYDQLVKITHVLGTDDLYEYLDKYGIELDEHYDGCIKDCPRVPWVKFIKPETVHLATDEAIDLLDKLLVYDHQARLTAMEAMEHPFFRQVKQTLSGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.19
5 0.23
6 0.27
7 0.28
8 0.3
9 0.32
10 0.32
11 0.31
12 0.31
13 0.29
14 0.29
15 0.25
16 0.21
17 0.19
18 0.22
19 0.23
20 0.28
21 0.24
22 0.22
23 0.21
24 0.2
25 0.2
26 0.17
27 0.15
28 0.1
29 0.12
30 0.11
31 0.13
32 0.13
33 0.15
34 0.18
35 0.2
36 0.22
37 0.23
38 0.25
39 0.29
40 0.31
41 0.35
42 0.37
43 0.37
44 0.37
45 0.37
46 0.34
47 0.3
48 0.29
49 0.26
50 0.22
51 0.19
52 0.19
53 0.25
54 0.29
55 0.32
56 0.36
57 0.42
58 0.44
59 0.47
60 0.55
61 0.56
62 0.53
63 0.58
64 0.62
65 0.62
66 0.67
67 0.74
68 0.74
69 0.74
70 0.8
71 0.82
72 0.83
73 0.86
74 0.86
75 0.87
76 0.85
77 0.84
78 0.85
79 0.77
80 0.68
81 0.59
82 0.51
83 0.41
84 0.33
85 0.23
86 0.13
87 0.12
88 0.09
89 0.07
90 0.06
91 0.05
92 0.06
93 0.07
94 0.07
95 0.06
96 0.07
97 0.08
98 0.1
99 0.13
100 0.16
101 0.15
102 0.16
103 0.17
104 0.18
105 0.19
106 0.19
107 0.17
108 0.18
109 0.21
110 0.2
111 0.2
112 0.19
113 0.18
114 0.17
115 0.16
116 0.11
117 0.13
118 0.13
119 0.13
120 0.12
121 0.12
122 0.13
123 0.14
124 0.15
125 0.1
126 0.11
127 0.11
128 0.11
129 0.1
130 0.1
131 0.09
132 0.08
133 0.08
134 0.07
135 0.07
136 0.08
137 0.08
138 0.07
139 0.1
140 0.1
141 0.11
142 0.14
143 0.13
144 0.12
145 0.16
146 0.21
147 0.25
148 0.28
149 0.31
150 0.35
151 0.37
152 0.4
153 0.38
154 0.34
155 0.29
156 0.26
157 0.24
158 0.21
159 0.23
160 0.21
161 0.24
162 0.22
163 0.2
164 0.21
165 0.2
166 0.16
167 0.14
168 0.14
169 0.1
170 0.1
171 0.1
172 0.08
173 0.07
174 0.07
175 0.06
176 0.05
177 0.04
178 0.04
179 0.04
180 0.05
181 0.07
182 0.06
183 0.08
184 0.08
185 0.08
186 0.08
187 0.09
188 0.13
189 0.14
190 0.17
191 0.17
192 0.18
193 0.19
194 0.19
195 0.22
196 0.2
197 0.21
198 0.18
199 0.17
200 0.16
201 0.15
202 0.14
203 0.11
204 0.08
205 0.06
206 0.06
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.04
214 0.03
215 0.03
216 0.03
217 0.05
218 0.06
219 0.07
220 0.07
221 0.08
222 0.08
223 0.1
224 0.11
225 0.12
226 0.15
227 0.16
228 0.17
229 0.19
230 0.23
231 0.25
232 0.27
233 0.25
234 0.21
235 0.19
236 0.18
237 0.17
238 0.13
239 0.12
240 0.1
241 0.1
242 0.1
243 0.11
244 0.11
245 0.1
246 0.11
247 0.1
248 0.1
249 0.09
250 0.09
251 0.09
252 0.09
253 0.09
254 0.08
255 0.08
256 0.09
257 0.09
258 0.09
259 0.09
260 0.11
261 0.13
262 0.14
263 0.14
264 0.15
265 0.14
266 0.16
267 0.21
268 0.19
269 0.22
270 0.27
271 0.29
272 0.34
273 0.43
274 0.43
275 0.47
276 0.54
277 0.56
278 0.58
279 0.59
280 0.61
281 0.54
282 0.57
283 0.54
284 0.5
285 0.43
286 0.37
287 0.35
288 0.26
289 0.24
290 0.2
291 0.12
292 0.08
293 0.08
294 0.07
295 0.06
296 0.06
297 0.06
298 0.05
299 0.06
300 0.07
301 0.12
302 0.19
303 0.2
304 0.22
305 0.23
306 0.23
307 0.23
308 0.24
309 0.22
310 0.15
311 0.14
312 0.14
313 0.17
314 0.19
315 0.18
316 0.18
317 0.22
318 0.23
319 0.23
320 0.3
321 0.3
322 0.33
323 0.38