Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075B4T7

Protein Details
Accession A0A075B4T7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
235-257RLDYEAKKKRRSETIKKHKITIEBasic
NLS Segment(s)
PositionSequence
241-251KKKRRSETIKK
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR006145  PsdUridine_synth_RsuA/RluA  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
Pfam View protein in Pfam  
PF00849  PseudoU_synth_2  
Amino Acid Sequences MTKPFPANVPIHIIKKTKDFLFVVKPHGVKSTENCPNSITREPSLAHYLERQLKAEEFKYEVLEPCYGISKNSHGIMAYIHNYNTLERFKSGEISFMKHYAALVHSSPVEKEGIIRLPIRNSKIDFKGDEAETYYRVENRLTDKYSLLHVACKTNISNQIELHLDHLKCPLIGDNIAAYKAENGMLREELSIKDFPKFLSLCTVDVSDIQGSIDFTLSYSTSDVFSYLLGNLRLRLDYEAKKKRRSETIKKHKITIENFFSKTMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.48
4 0.41
5 0.42
6 0.4
7 0.4
8 0.46
9 0.47
10 0.46
11 0.47
12 0.46
13 0.41
14 0.44
15 0.4
16 0.34
17 0.35
18 0.39
19 0.41
20 0.42
21 0.41
22 0.38
23 0.4
24 0.42
25 0.44
26 0.38
27 0.3
28 0.33
29 0.33
30 0.35
31 0.36
32 0.31
33 0.26
34 0.25
35 0.31
36 0.35
37 0.35
38 0.33
39 0.3
40 0.32
41 0.35
42 0.33
43 0.29
44 0.24
45 0.23
46 0.24
47 0.24
48 0.24
49 0.22
50 0.21
51 0.18
52 0.16
53 0.19
54 0.16
55 0.15
56 0.15
57 0.16
58 0.19
59 0.19
60 0.19
61 0.15
62 0.15
63 0.16
64 0.17
65 0.16
66 0.14
67 0.13
68 0.14
69 0.14
70 0.15
71 0.17
72 0.16
73 0.15
74 0.14
75 0.17
76 0.16
77 0.2
78 0.2
79 0.22
80 0.21
81 0.23
82 0.24
83 0.23
84 0.22
85 0.18
86 0.18
87 0.12
88 0.12
89 0.11
90 0.1
91 0.1
92 0.1
93 0.11
94 0.1
95 0.1
96 0.1
97 0.07
98 0.08
99 0.09
100 0.1
101 0.12
102 0.14
103 0.14
104 0.18
105 0.22
106 0.23
107 0.24
108 0.24
109 0.28
110 0.29
111 0.31
112 0.27
113 0.25
114 0.27
115 0.24
116 0.22
117 0.19
118 0.16
119 0.14
120 0.15
121 0.13
122 0.1
123 0.11
124 0.11
125 0.11
126 0.15
127 0.18
128 0.19
129 0.2
130 0.2
131 0.2
132 0.21
133 0.22
134 0.17
135 0.17
136 0.16
137 0.17
138 0.17
139 0.17
140 0.17
141 0.18
142 0.24
143 0.23
144 0.24
145 0.22
146 0.23
147 0.23
148 0.22
149 0.21
150 0.2
151 0.18
152 0.17
153 0.18
154 0.16
155 0.15
156 0.15
157 0.15
158 0.11
159 0.11
160 0.11
161 0.11
162 0.11
163 0.11
164 0.11
165 0.09
166 0.07
167 0.08
168 0.09
169 0.09
170 0.09
171 0.11
172 0.11
173 0.12
174 0.12
175 0.13
176 0.11
177 0.13
178 0.15
179 0.14
180 0.15
181 0.16
182 0.15
183 0.2
184 0.2
185 0.17
186 0.23
187 0.23
188 0.22
189 0.23
190 0.23
191 0.18
192 0.18
193 0.19
194 0.12
195 0.1
196 0.09
197 0.09
198 0.08
199 0.08
200 0.08
201 0.06
202 0.06
203 0.07
204 0.08
205 0.08
206 0.08
207 0.09
208 0.09
209 0.09
210 0.1
211 0.08
212 0.08
213 0.08
214 0.09
215 0.12
216 0.13
217 0.14
218 0.15
219 0.17
220 0.17
221 0.17
222 0.2
223 0.23
224 0.3
225 0.4
226 0.49
227 0.55
228 0.63
229 0.68
230 0.72
231 0.76
232 0.78
233 0.79
234 0.8
235 0.83
236 0.86
237 0.83
238 0.83
239 0.78
240 0.77
241 0.72
242 0.7
243 0.68
244 0.65
245 0.63