Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075ASP7

Protein Details
Accession A0A075ASP7   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
107-142APLNRKKKFASRDPVRLYREHQKDWKKQANLHKINKHydrophilic
NLS Segment(s)
PositionSequence
110-117NRKKKFAS
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MEKQRLPSLFPICKTSVLAHLSALGYCNIPESIVNEFVNELQEYETVLTNNSTCEPESHEKEYEKDTSEPVDIIIENRAQTCHKTSRDSDSHKANDWDNNLERPKTAPLNRKKKFASRDPVRLYREHQKDWKKQANLHKINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.35
3 0.32
4 0.29
5 0.27
6 0.22
7 0.22
8 0.21
9 0.19
10 0.18
11 0.12
12 0.1
13 0.09
14 0.11
15 0.08
16 0.08
17 0.08
18 0.09
19 0.11
20 0.15
21 0.15
22 0.13
23 0.14
24 0.14
25 0.15
26 0.14
27 0.11
28 0.08
29 0.08
30 0.08
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.15
43 0.2
44 0.25
45 0.27
46 0.29
47 0.29
48 0.3
49 0.32
50 0.28
51 0.25
52 0.22
53 0.19
54 0.17
55 0.17
56 0.15
57 0.12
58 0.11
59 0.08
60 0.07
61 0.08
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.1
68 0.14
69 0.2
70 0.22
71 0.26
72 0.28
73 0.35
74 0.42
75 0.47
76 0.47
77 0.48
78 0.48
79 0.47
80 0.47
81 0.41
82 0.38
83 0.34
84 0.35
85 0.29
86 0.33
87 0.33
88 0.32
89 0.3
90 0.28
91 0.3
92 0.32
93 0.37
94 0.41
95 0.48
96 0.59
97 0.63
98 0.69
99 0.69
100 0.7
101 0.71
102 0.71
103 0.72
104 0.7
105 0.77
106 0.77
107 0.8
108 0.75
109 0.7
110 0.66
111 0.66
112 0.64
113 0.61
114 0.62
115 0.64
116 0.7
117 0.77
118 0.81
119 0.77
120 0.77
121 0.8
122 0.82