Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AVJ4

Protein Details
Accession A0A075AVJ4    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
140-159EPYLKQKRPRLRHEMKENYQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036010  2Fe-2S_ferredoxin-like_sf  
IPR001041  2Fe-2S_ferredoxin-type  
IPR006058  2Fe2S_fd_BS  
IPR017896  4Fe4S_Fe-S-bd  
IPR017900  4Fe4S_Fe_S_CS  
IPR012675  Beta-grasp_dom_sf  
IPR009051  Helical_ferredxn  
IPR004489  Succ_DH/fum_Rdtase_Fe-S  
IPR025192  Succ_DH/fum_Rdtase_N  
Gene Ontology GO:0000329  C:fungal-type vacuole membrane  
GO:0005749  C:mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)  
GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0051538  F:3 iron, 4 sulfur cluster binding  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0009055  F:electron transfer activity  
GO:0102040  F:fumarate reductase (menaquinone)  
GO:0046872  F:metal ion binding  
GO:0008177  F:succinate dehydrogenase (ubiquinone) activity  
GO:0006121  P:mitochondrial electron transport, succinate to ubiquinone  
GO:0042776  P:proton motive force-driven mitochondrial ATP synthesis  
GO:0006099  P:tricarboxylic acid cycle  
Pfam View protein in Pfam  
PF13085  Fer2_3  
PF13534  Fer4_17  
PROSITE View protein in PROSITE  
PS00197  2FE2S_FER_1  
PS51085  2FE2S_FER_2  
PS00198  4FE4S_FER_1  
PS51379  4FE4S_FER_2  
Amino Acid Sequences MFRTRSTITRIARLFSTKTAAGDAIKTFSIYRWDPEKPNQKPYMQNYEVDLSTCGPMVLDALVKIKNEIDPTLAFRRSCREGICGSCSMNINGVNTLACLAKIDRDVSSKTKIHPLPHMYVIRDLVPDLSLFYKQYKSIEPYLKQKRPRLRHEMKENYQSIQDREKLDGLYECILCACCSTACPSYWWNQDKYLGPAVLMQAYRWIIDSRDEYGYERRQKMQDPFSVYRCHTIMNCAKTCPKGLNPGFAIAKLKKLMAED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.37
4 0.3
5 0.29
6 0.28
7 0.26
8 0.23
9 0.23
10 0.21
11 0.18
12 0.17
13 0.17
14 0.15
15 0.15
16 0.21
17 0.19
18 0.23
19 0.26
20 0.31
21 0.36
22 0.46
23 0.55
24 0.54
25 0.62
26 0.63
27 0.63
28 0.67
29 0.69
30 0.69
31 0.61
32 0.57
33 0.5
34 0.48
35 0.42
36 0.34
37 0.28
38 0.19
39 0.17
40 0.15
41 0.12
42 0.08
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.08
49 0.1
50 0.1
51 0.11
52 0.11
53 0.13
54 0.14
55 0.14
56 0.14
57 0.14
58 0.19
59 0.24
60 0.27
61 0.25
62 0.24
63 0.29
64 0.31
65 0.32
66 0.29
67 0.26
68 0.27
69 0.3
70 0.33
71 0.29
72 0.25
73 0.25
74 0.25
75 0.21
76 0.2
77 0.18
78 0.15
79 0.13
80 0.13
81 0.1
82 0.09
83 0.1
84 0.07
85 0.06
86 0.06
87 0.06
88 0.07
89 0.08
90 0.1
91 0.1
92 0.12
93 0.15
94 0.18
95 0.23
96 0.24
97 0.24
98 0.31
99 0.33
100 0.33
101 0.37
102 0.38
103 0.35
104 0.4
105 0.41
106 0.33
107 0.31
108 0.3
109 0.24
110 0.19
111 0.16
112 0.1
113 0.08
114 0.07
115 0.06
116 0.06
117 0.06
118 0.07
119 0.08
120 0.09
121 0.1
122 0.12
123 0.13
124 0.16
125 0.22
126 0.28
127 0.3
128 0.39
129 0.48
130 0.53
131 0.57
132 0.61
133 0.64
134 0.67
135 0.72
136 0.73
137 0.72
138 0.75
139 0.79
140 0.81
141 0.77
142 0.76
143 0.69
144 0.59
145 0.54
146 0.47
147 0.39
148 0.34
149 0.33
150 0.26
151 0.26
152 0.27
153 0.23
154 0.22
155 0.2
156 0.17
157 0.15
158 0.14
159 0.12
160 0.11
161 0.11
162 0.1
163 0.09
164 0.09
165 0.06
166 0.07
167 0.11
168 0.13
169 0.13
170 0.16
171 0.17
172 0.23
173 0.32
174 0.35
175 0.33
176 0.33
177 0.37
178 0.37
179 0.39
180 0.37
181 0.29
182 0.25
183 0.24
184 0.23
185 0.22
186 0.19
187 0.15
188 0.14
189 0.15
190 0.14
191 0.15
192 0.14
193 0.12
194 0.16
195 0.18
196 0.18
197 0.2
198 0.2
199 0.22
200 0.28
201 0.36
202 0.42
203 0.43
204 0.45
205 0.47
206 0.53
207 0.58
208 0.59
209 0.56
210 0.56
211 0.57
212 0.56
213 0.58
214 0.52
215 0.49
216 0.42
217 0.38
218 0.3
219 0.34
220 0.38
221 0.4
222 0.41
223 0.4
224 0.45
225 0.45
226 0.47
227 0.44
228 0.41
229 0.43
230 0.44
231 0.48
232 0.45
233 0.49
234 0.47
235 0.43
236 0.46
237 0.36
238 0.39
239 0.33
240 0.32