Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075AQ85

Protein Details
Accession A0A075AQ85    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-76EFYRQKTKKEILKKHKLENEKRKKILSBasic
NLS Segment(s)
PositionSequence
55-73KTKKEILKKHKLENEKRKK
Subcellular Location(s) nucl 11, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01585  G-patch  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MLAGWEGKGLGKHAEGITKPITYAKKLDRKGLGMSIDIKEVESEKQNPFEFYRQKTKKEILKKHKLENEKRKKILSYLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.23
4 0.23
5 0.21
6 0.21
7 0.23
8 0.25
9 0.22
10 0.27
11 0.32
12 0.39
13 0.41
14 0.47
15 0.44
16 0.44
17 0.44
18 0.42
19 0.34
20 0.26
21 0.27
22 0.21
23 0.18
24 0.16
25 0.13
26 0.1
27 0.1
28 0.1
29 0.1
30 0.13
31 0.14
32 0.18
33 0.19
34 0.21
35 0.22
36 0.29
37 0.32
38 0.34
39 0.44
40 0.44
41 0.48
42 0.52
43 0.57
44 0.58
45 0.62
46 0.68
47 0.68
48 0.74
49 0.77
50 0.8
51 0.81
52 0.83
53 0.84
54 0.84
55 0.85
56 0.84
57 0.83
58 0.78
59 0.73
60 0.69