Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075AMU0

Protein Details
Accession A0A075AMU0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGASQKKKKWSKGKVKEKSNNAVTFHydrophilic
NLS Segment(s)
PositionSequence
6-17KKKKWSKGKVKE
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MGASQKKKKWSKGKVKEKSNNAVTFDKNTYDRLFKEVPTYKLITPAVLMDRLKITGSLARRALREFEEKGLIRPVVSHSTLKAYTRATAAVAEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.92
4 0.89
5 0.87
6 0.84
7 0.77
8 0.71
9 0.65
10 0.56
11 0.51
12 0.44
13 0.38
14 0.31
15 0.29
16 0.26
17 0.26
18 0.25
19 0.25
20 0.25
21 0.22
22 0.3
23 0.32
24 0.32
25 0.32
26 0.34
27 0.29
28 0.32
29 0.32
30 0.23
31 0.18
32 0.17
33 0.14
34 0.14
35 0.14
36 0.09
37 0.1
38 0.1
39 0.1
40 0.09
41 0.09
42 0.1
43 0.12
44 0.16
45 0.19
46 0.21
47 0.22
48 0.23
49 0.24
50 0.24
51 0.27
52 0.25
53 0.24
54 0.28
55 0.28
56 0.28
57 0.3
58 0.27
59 0.22
60 0.21
61 0.23
62 0.21
63 0.23
64 0.23
65 0.2
66 0.25
67 0.27
68 0.28
69 0.28
70 0.25
71 0.24
72 0.24
73 0.24
74 0.19
75 0.18