Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075AR44

Protein Details
Accession A0A075AR44    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-63SEQTLQRKRPRKRSFSEPKVDPHydrophilic
NLS Segment(s)
PositionSequence
49-54KRPRKR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MDQKTKKETTTIDSTVKDASENKQAVEANETKDILSKSLEVSEQTLQRKRPRKRSFSEPKVDPTSGPNIPDSKKLKEDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.32
4 0.27
5 0.21
6 0.2
7 0.24
8 0.23
9 0.22
10 0.25
11 0.25
12 0.24
13 0.28
14 0.27
15 0.21
16 0.22
17 0.22
18 0.18
19 0.2
20 0.2
21 0.15
22 0.13
23 0.11
24 0.1
25 0.11
26 0.11
27 0.08
28 0.1
29 0.12
30 0.16
31 0.2
32 0.24
33 0.28
34 0.36
35 0.46
36 0.52
37 0.61
38 0.66
39 0.71
40 0.73
41 0.79
42 0.82
43 0.82
44 0.83
45 0.76
46 0.74
47 0.71
48 0.65
49 0.54
50 0.47
51 0.44
52 0.37
53 0.34
54 0.3
55 0.29
56 0.3
57 0.38
58 0.39
59 0.39