Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AVD3

Protein Details
Accession A0A075AVD3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
283-308YFTVDSRINLKKRRKVRNGDNMEVDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007133  RNA_pol_II-assoc_Paf1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF03985  Paf1  
Amino Acid Sequences MSKDTQKDVVKKTVGSEFLCRPRYTNTLPAISIPPRHLVIPVDYSSLIEYQLTDIEREYVHPIFLNDPLAAIPIDSLEFEYWKSQNGALEKEDEELIADISLDRKRISRPEVSWLRRTEYISSEVNKSRSNRKSTRKSLVEETISEDQKRTIIASSFDKKELKHPTKPHLKVVEDLPLYPDLIFFGQTFSRCFFDDCPNFKVQKGDDPENSEFRDIQGENGILRGVTNPNDPSDQFLAFYLPSETFLKDQKDEKYLLIREYDFQAAENDPKFAFIFHGDKVTYFTVDSRINLKKRRKVRNGDNMEVDEDLPKVIQVSRAKDGKFIDENEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.43
4 0.43
5 0.48
6 0.53
7 0.49
8 0.45
9 0.45
10 0.5
11 0.49
12 0.49
13 0.46
14 0.44
15 0.44
16 0.45
17 0.45
18 0.41
19 0.4
20 0.34
21 0.32
22 0.29
23 0.29
24 0.28
25 0.24
26 0.24
27 0.25
28 0.24
29 0.23
30 0.22
31 0.22
32 0.21
33 0.19
34 0.16
35 0.11
36 0.1
37 0.08
38 0.11
39 0.11
40 0.11
41 0.11
42 0.12
43 0.12
44 0.13
45 0.17
46 0.14
47 0.14
48 0.15
49 0.16
50 0.16
51 0.17
52 0.17
53 0.13
54 0.12
55 0.12
56 0.12
57 0.1
58 0.08
59 0.07
60 0.05
61 0.06
62 0.06
63 0.07
64 0.06
65 0.07
66 0.08
67 0.12
68 0.12
69 0.14
70 0.15
71 0.15
72 0.18
73 0.2
74 0.22
75 0.2
76 0.22
77 0.21
78 0.21
79 0.19
80 0.15
81 0.13
82 0.11
83 0.09
84 0.06
85 0.06
86 0.05
87 0.08
88 0.09
89 0.1
90 0.1
91 0.12
92 0.15
93 0.21
94 0.26
95 0.3
96 0.3
97 0.4
98 0.49
99 0.52
100 0.56
101 0.52
102 0.51
103 0.47
104 0.47
105 0.39
106 0.32
107 0.31
108 0.28
109 0.28
110 0.29
111 0.29
112 0.3
113 0.31
114 0.31
115 0.37
116 0.41
117 0.48
118 0.52
119 0.59
120 0.67
121 0.7
122 0.77
123 0.73
124 0.69
125 0.66
126 0.63
127 0.54
128 0.45
129 0.42
130 0.37
131 0.33
132 0.3
133 0.24
134 0.19
135 0.17
136 0.17
137 0.13
138 0.09
139 0.08
140 0.11
141 0.16
142 0.21
143 0.22
144 0.24
145 0.25
146 0.24
147 0.3
148 0.39
149 0.39
150 0.42
151 0.45
152 0.51
153 0.6
154 0.62
155 0.62
156 0.57
157 0.52
158 0.47
159 0.44
160 0.42
161 0.31
162 0.29
163 0.23
164 0.18
165 0.17
166 0.15
167 0.13
168 0.07
169 0.06
170 0.07
171 0.06
172 0.07
173 0.08
174 0.09
175 0.1
176 0.11
177 0.12
178 0.12
179 0.13
180 0.15
181 0.22
182 0.29
183 0.32
184 0.34
185 0.37
186 0.37
187 0.36
188 0.37
189 0.29
190 0.3
191 0.32
192 0.33
193 0.32
194 0.38
195 0.4
196 0.39
197 0.4
198 0.33
199 0.27
200 0.22
201 0.24
202 0.18
203 0.16
204 0.15
205 0.15
206 0.13
207 0.14
208 0.13
209 0.08
210 0.08
211 0.09
212 0.08
213 0.09
214 0.12
215 0.13
216 0.15
217 0.17
218 0.17
219 0.2
220 0.2
221 0.19
222 0.16
223 0.16
224 0.15
225 0.13
226 0.14
227 0.11
228 0.09
229 0.11
230 0.12
231 0.13
232 0.14
233 0.18
234 0.21
235 0.23
236 0.27
237 0.28
238 0.31
239 0.31
240 0.32
241 0.35
242 0.34
243 0.33
244 0.32
245 0.29
246 0.27
247 0.28
248 0.28
249 0.2
250 0.18
251 0.18
252 0.17
253 0.21
254 0.2
255 0.19
256 0.16
257 0.18
258 0.17
259 0.15
260 0.15
261 0.15
262 0.17
263 0.16
264 0.2
265 0.19
266 0.19
267 0.23
268 0.22
269 0.19
270 0.17
271 0.17
272 0.18
273 0.2
274 0.21
275 0.25
276 0.32
277 0.39
278 0.47
279 0.56
280 0.6
281 0.68
282 0.78
283 0.81
284 0.83
285 0.87
286 0.89
287 0.88
288 0.86
289 0.82
290 0.73
291 0.65
292 0.55
293 0.44
294 0.34
295 0.25
296 0.19
297 0.12
298 0.1
299 0.1
300 0.1
301 0.17
302 0.21
303 0.27
304 0.35
305 0.41
306 0.42
307 0.45
308 0.46
309 0.47
310 0.46