Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AXE3

Protein Details
Accession A0A075AXE3   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-49LNRIAIVKKRTKKFVRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-52KKRTKKFVRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQIP
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAPLNRIAIVKKRTKKFVRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQIPMPKIGYGSNKKTRDLMPNGFKRFVIRNVKELELLMMHNREYSAEIAHNVSSKNRIEIVKRANEMSIKLTNAFAKLRTEESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.77
4 0.8
5 0.83
6 0.84
7 0.85
8 0.87
9 0.88
10 0.89
11 0.85
12 0.79
13 0.72
14 0.62
15 0.62
16 0.6
17 0.58
18 0.6
19 0.63
20 0.69
21 0.66
22 0.67
23 0.67
24 0.69
25 0.69
26 0.68
27 0.69
28 0.7
29 0.78
30 0.82
31 0.76
32 0.73
33 0.7
34 0.67
35 0.67
36 0.63
37 0.63
38 0.63
39 0.65
40 0.59
41 0.52
42 0.45
43 0.37
44 0.37
45 0.33
46 0.34
47 0.39
48 0.4
49 0.4
50 0.42
51 0.43
52 0.43
53 0.43
54 0.42
55 0.42
56 0.47
57 0.49
58 0.48
59 0.45
60 0.4
61 0.37
62 0.38
63 0.4
64 0.34
65 0.36
66 0.38
67 0.39
68 0.37
69 0.33
70 0.26
71 0.16
72 0.15
73 0.13
74 0.11
75 0.1
76 0.1
77 0.1
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.11
84 0.12
85 0.13
86 0.14
87 0.13
88 0.14
89 0.17
90 0.17
91 0.18
92 0.21
93 0.24
94 0.26
95 0.33
96 0.4
97 0.42
98 0.43
99 0.42
100 0.41
101 0.4
102 0.38
103 0.35
104 0.31
105 0.25
106 0.24
107 0.25
108 0.25
109 0.26
110 0.26
111 0.23
112 0.23
113 0.24