Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075B167

Protein Details
Accession A0A075B167    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-93VTPHLGPKIKAKRTKRYFTKNLTSLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6, E.R. 5, golg 5, vacu 3, cyto 2, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MYYWLTPVTLYFLILICPNLIKTAHFKEIEKTALNEQVYTDPNLSFLVGTDEYLAPEIISGIGHDRSVTPHLGPKIKAKRTKRYFTKNLTSLVIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.08
4 0.09
5 0.09
6 0.1
7 0.1
8 0.11
9 0.16
10 0.21
11 0.27
12 0.28
13 0.28
14 0.3
15 0.34
16 0.35
17 0.3
18 0.27
19 0.23
20 0.27
21 0.26
22 0.23
23 0.2
24 0.2
25 0.2
26 0.19
27 0.17
28 0.12
29 0.12
30 0.12
31 0.11
32 0.08
33 0.06
34 0.08
35 0.07
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.08
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.07
52 0.07
53 0.09
54 0.12
55 0.13
56 0.12
57 0.17
58 0.22
59 0.26
60 0.28
61 0.35
62 0.43
63 0.51
64 0.6
65 0.63
66 0.69
67 0.75
68 0.84
69 0.84
70 0.84
71 0.86
72 0.86
73 0.88
74 0.81
75 0.75