Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AT44

Protein Details
Accession A0A075AT44    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
258-301RDDQHRRSDTRRHEKRDDRYQDRRRDDRMSREGYSRRRRSRSPYBasic
NLS Segment(s)
PositionSequence
280-298RRRDDRMSREGYSRRRRSR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004882  Luc7-rel  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0003729  F:mRNA binding  
GO:0006376  P:mRNA splice site selection  
Pfam View protein in Pfam  
PF03194  LUC7  
Amino Acid Sequences MAIEYSRKMLDRLMGTDRNDLEAKGGLKFNDPEVCKTFIARFCPHEMFQHTKMGRIVGDCPYKHHDDYLRDAYLGKEGDKYREKYEMELYEFLEDLVQELDKSMRKGRERLDFRSTDEVMQLVKELLVKIEDFGEQGMIDEAQNLTKEVDKIKLEIDRLRAIEDVNPYLKLEKRMQVCDVCGLLLVMNDDPKRMEAHIAGKQHVGFLKVRKTLQEFRDKYGPIRLRRSRITSMDNLNDDNPNSYRPSRQSHSRMVDHRDDQHRRSDTRRHEKRDDRYQDRRRDDRMSREGYSRRRRSRSPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.44
4 0.42
5 0.4
6 0.38
7 0.33
8 0.27
9 0.26
10 0.24
11 0.22
12 0.23
13 0.2
14 0.24
15 0.25
16 0.27
17 0.3
18 0.31
19 0.33
20 0.34
21 0.37
22 0.33
23 0.34
24 0.37
25 0.34
26 0.39
27 0.38
28 0.38
29 0.4
30 0.44
31 0.43
32 0.43
33 0.44
34 0.44
35 0.43
36 0.48
37 0.42
38 0.42
39 0.41
40 0.37
41 0.32
42 0.27
43 0.27
44 0.25
45 0.32
46 0.28
47 0.32
48 0.35
49 0.39
50 0.38
51 0.4
52 0.38
53 0.35
54 0.43
55 0.44
56 0.4
57 0.35
58 0.35
59 0.31
60 0.29
61 0.26
62 0.19
63 0.18
64 0.19
65 0.26
66 0.32
67 0.35
68 0.33
69 0.4
70 0.39
71 0.36
72 0.42
73 0.39
74 0.35
75 0.34
76 0.31
77 0.25
78 0.25
79 0.22
80 0.15
81 0.1
82 0.07
83 0.06
84 0.06
85 0.05
86 0.05
87 0.08
88 0.1
89 0.12
90 0.17
91 0.23
92 0.26
93 0.32
94 0.37
95 0.44
96 0.48
97 0.52
98 0.54
99 0.49
100 0.49
101 0.51
102 0.46
103 0.36
104 0.3
105 0.25
106 0.18
107 0.16
108 0.13
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.05
125 0.04
126 0.04
127 0.04
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.07
134 0.08
135 0.08
136 0.12
137 0.12
138 0.13
139 0.14
140 0.16
141 0.17
142 0.19
143 0.2
144 0.19
145 0.19
146 0.2
147 0.18
148 0.16
149 0.17
150 0.16
151 0.15
152 0.13
153 0.13
154 0.12
155 0.14
156 0.16
157 0.17
158 0.19
159 0.22
160 0.25
161 0.27
162 0.3
163 0.29
164 0.28
165 0.26
166 0.23
167 0.17
168 0.13
169 0.11
170 0.08
171 0.07
172 0.07
173 0.05
174 0.08
175 0.09
176 0.09
177 0.09
178 0.1
179 0.11
180 0.1
181 0.12
182 0.11
183 0.17
184 0.22
185 0.24
186 0.24
187 0.24
188 0.24
189 0.24
190 0.23
191 0.19
192 0.17
193 0.2
194 0.26
195 0.29
196 0.29
197 0.31
198 0.37
199 0.42
200 0.46
201 0.52
202 0.48
203 0.49
204 0.55
205 0.52
206 0.48
207 0.5
208 0.5
209 0.46
210 0.55
211 0.57
212 0.56
213 0.61
214 0.66
215 0.63
216 0.61
217 0.6
218 0.56
219 0.55
220 0.54
221 0.5
222 0.45
223 0.4
224 0.37
225 0.31
226 0.28
227 0.23
228 0.19
229 0.22
230 0.22
231 0.27
232 0.3
233 0.37
234 0.39
235 0.48
236 0.53
237 0.58
238 0.64
239 0.66
240 0.67
241 0.67
242 0.69
243 0.64
244 0.65
245 0.66
246 0.65
247 0.6
248 0.63
249 0.62
250 0.59
251 0.61
252 0.62
253 0.63
254 0.67
255 0.75
256 0.74
257 0.78
258 0.84
259 0.87
260 0.88
261 0.88
262 0.86
263 0.87
264 0.88
265 0.88
266 0.88
267 0.86
268 0.81
269 0.8
270 0.79
271 0.78
272 0.77
273 0.74
274 0.67
275 0.68
276 0.7
277 0.71
278 0.74
279 0.75
280 0.76
281 0.77