Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075AUU0

Protein Details
Accession A0A075AUU0    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPKPKGKGGKNRRKGKSESESKRBasic
NLS Segment(s)
PositionSequence
3-18KPKGKGGKNRRKGKSE
54-67KKRQGHIRGKMRKK
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006196  RNA-binding_domain_S1_IF1  
IPR001253  TIF_eIF-1A  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0003725  F:double-stranded RNA binding  
GO:0019901  F:protein kinase binding  
GO:0043024  F:ribosomal small subunit binding  
GO:0003743  F:translation initiation factor activity  
GO:0031369  F:translation initiation factor binding  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
GO:0001677  P:formation of translation initiation ternary complex  
GO:0001731  P:formation of translation preinitiation complex  
GO:0002188  P:translation reinitiation  
Pfam View protein in Pfam  
PF01176  eIF-1a  
PROSITE View protein in PROSITE  
PS50832  S1_IF1_TYPE  
CDD cd05793  S1_IF1A  
Amino Acid Sequences MPKPKGKGGKNRRKGKSESESKRELIYKDEEQEYGQVVKMLGNARVELSCFDGKKRQGHIRGKMRKKVWIGTGDIVLCSLRDFQDDKCDIIAKYFPDEARQLVAEGELPDDVNIMEVAEGEPEDDNDMMGSDEDDVPPQQLRDADIDNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.81
4 0.8
5 0.8
6 0.76
7 0.73
8 0.67
9 0.66
10 0.6
11 0.5
12 0.43
13 0.4
14 0.37
15 0.37
16 0.37
17 0.33
18 0.29
19 0.29
20 0.26
21 0.21
22 0.17
23 0.13
24 0.11
25 0.11
26 0.13
27 0.14
28 0.14
29 0.14
30 0.14
31 0.14
32 0.14
33 0.14
34 0.11
35 0.14
36 0.15
37 0.15
38 0.17
39 0.22
40 0.26
41 0.31
42 0.37
43 0.4
44 0.47
45 0.55
46 0.63
47 0.67
48 0.73
49 0.76
50 0.77
51 0.71
52 0.68
53 0.63
54 0.57
55 0.51
56 0.44
57 0.39
58 0.32
59 0.32
60 0.25
61 0.22
62 0.18
63 0.13
64 0.09
65 0.07
66 0.06
67 0.05
68 0.07
69 0.08
70 0.08
71 0.17
72 0.18
73 0.18
74 0.18
75 0.2
76 0.18
77 0.18
78 0.2
79 0.13
80 0.14
81 0.16
82 0.15
83 0.16
84 0.18
85 0.17
86 0.16
87 0.15
88 0.13
89 0.11
90 0.11
91 0.1
92 0.09
93 0.09
94 0.07
95 0.07
96 0.07
97 0.07
98 0.06
99 0.05
100 0.05
101 0.04
102 0.04
103 0.04
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.07
111 0.07
112 0.07
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.08
121 0.1
122 0.1
123 0.12
124 0.13
125 0.13
126 0.14
127 0.14
128 0.16
129 0.18