Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GNP6

Protein Details
Accession C1GNP6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
113-145KDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPHydrophilic
NLS Segment(s)
PositionSequence
64-72PQKARQRKR
122-135KEKKYRKGIHKLPK
Subcellular Location(s) mito 16, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG pbl:PAAG_00141  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSPLMGGLLWYENDNSPDTTAPIALQPKLIAMTLPLPHITLLTKHPLYANRKIPWRLSAPQKARQRKRLRAVDKVVDTVSAALERKGMTSKAVTRWFAEMPREEEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.14
5 0.15
6 0.15
7 0.15
8 0.15
9 0.15
10 0.14
11 0.13
12 0.12
13 0.14
14 0.17
15 0.16
16 0.16
17 0.14
18 0.14
19 0.15
20 0.14
21 0.1
22 0.08
23 0.12
24 0.12
25 0.13
26 0.13
27 0.12
28 0.12
29 0.13
30 0.12
31 0.1
32 0.12
33 0.17
34 0.17
35 0.17
36 0.2
37 0.26
38 0.32
39 0.38
40 0.43
41 0.41
42 0.48
43 0.5
44 0.49
45 0.46
46 0.45
47 0.42
48 0.43
49 0.48
50 0.48
51 0.54
52 0.61
53 0.67
54 0.69
55 0.74
56 0.75
57 0.74
58 0.79
59 0.8
60 0.76
61 0.74
62 0.72
63 0.68
64 0.59
65 0.51
66 0.42
67 0.32
68 0.26
69 0.18
70 0.13
71 0.08
72 0.07
73 0.06
74 0.07
75 0.07
76 0.08
77 0.09
78 0.09
79 0.09
80 0.12
81 0.16
82 0.22
83 0.27
84 0.27
85 0.27
86 0.3
87 0.3
88 0.29
89 0.3
90 0.26
91 0.24
92 0.26
93 0.26
94 0.23
95 0.24
96 0.25
97 0.28
98 0.25
99 0.22
100 0.21
101 0.22
102 0.25
103 0.28
104 0.34
105 0.32
106 0.41
107 0.48
108 0.56
109 0.65
110 0.71
111 0.74
112 0.74
113 0.81
114 0.82
115 0.86
116 0.87
117 0.87
118 0.87
119 0.89
120 0.89
121 0.88
122 0.83
123 0.81
124 0.81
125 0.81
126 0.81
127 0.78
128 0.8