Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A075ARN9

Protein Details
Accession A0A075ARN9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-65NYEPNYRKRKRKVGFLARLKTKHydrophilic
NLS Segment(s)
PositionSequence
50-84RKRKRKVGFLARLKTKAGKKILFRRWMKGRKHLGA
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLGIARRIGTSIIKISHAPYQKITNINTNPFQFVQIRSKVFFENYEPNYRKRKRKVGFLARLKTKAGKKILFRRWMKGRKHLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.27
4 0.3
5 0.29
6 0.28
7 0.31
8 0.34
9 0.37
10 0.37
11 0.39
12 0.38
13 0.41
14 0.42
15 0.38
16 0.36
17 0.32
18 0.32
19 0.25
20 0.24
21 0.26
22 0.26
23 0.27
24 0.25
25 0.26
26 0.25
27 0.24
28 0.21
29 0.19
30 0.22
31 0.23
32 0.31
33 0.32
34 0.36
35 0.46
36 0.52
37 0.58
38 0.59
39 0.67
40 0.63
41 0.71
42 0.78
43 0.79
44 0.82
45 0.82
46 0.82
47 0.77
48 0.75
49 0.66
50 0.62
51 0.57
52 0.54
53 0.53
54 0.5
55 0.53
56 0.62
57 0.69
58 0.72
59 0.71
60 0.72
61 0.75
62 0.78
63 0.76
64 0.76