Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A075B2Z4

Protein Details
Accession A0A075B2Z4   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-90LINRTVKIFNGKKKPKVNKEKHAKLINAKHydrophilic
NLS Segment(s)
PositionSequence
72-90GKKKPKVNKEKHAKLINAK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MSSSQTKAEKVHHLLKYKDLVKERKSLKEEWKSVKEQSELNDALKRKIRKLEIATLSFEDQLINRTVKIFNGKKKPKVNKEKHAKLINAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.57
4 0.53
5 0.53
6 0.52
7 0.54
8 0.51
9 0.58
10 0.58
11 0.58
12 0.58
13 0.57
14 0.59
15 0.61
16 0.64
17 0.64
18 0.64
19 0.59
20 0.58
21 0.56
22 0.48
23 0.4
24 0.35
25 0.33
26 0.28
27 0.27
28 0.28
29 0.24
30 0.26
31 0.29
32 0.29
33 0.25
34 0.3
35 0.31
36 0.33
37 0.37
38 0.42
39 0.42
40 0.43
41 0.42
42 0.37
43 0.36
44 0.29
45 0.25
46 0.16
47 0.11
48 0.11
49 0.12
50 0.11
51 0.1
52 0.12
53 0.13
54 0.15
55 0.24
56 0.29
57 0.36
58 0.46
59 0.55
60 0.62
61 0.72
62 0.81
63 0.82
64 0.87
65 0.88
66 0.88
67 0.91
68 0.91
69 0.91
70 0.89